(data stored in ACNUC7421 zone)

EMBL: CP001509.TOLB

CP001509.TOLB        Location/Qualifiers
FT   CDS_pept        736401..737693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="ECD_00700"
FT                   /product="periplasmic protein"
FT                   /note="similar to b0740"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42575"
FT                   /protein_id="ACT42575.1"
FT                   /translation="MKQALRVAFGFLILWASVLHAEVRIVIDSGVDSGRPIGVVPFQWA
FT                   GPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQV
FT                   TPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAF
FT                   RTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESG
FT                   RSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIR
FT                   QVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVS
FT                   SDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGS
FT                   VLNLVSTDGRFKARLPATDGQVKFPAWSPYL"
     atgaagcagg cattacgagt agcatttggt tttctcatac tgtgggcatc agttctgcat        60
     gctgaagtcc gcattgtgat cgacagcggt gtagattccg gtcgtcctat tggtgttgtt       120
     cctttccagt gggcggggcc tggtgcggca cctgaagata ttggcggcat cgttgctgct       180
     gacttgcgta acagcggtaa atttaatccg ttagatcgcg ctcgtctgcc acagcagccg       240
     ggtagtgcgc aggaagtaca accagctgca tggtccgcac tgggcattga cgctgtagtt       300
     gtcggtcagg tcactccgaa tccggatggt tcttacaatg ttgcttatca acttgttgac       360
     actggcggcg caccgggtac tgtacttgct cagaactcgt acaaagtgaa caagcagtgg       420
     ctgcgttatg ctggtcatac cgccagtgat gaagtgtttg aaaaactgac cggcattaaa       480
     ggtgcgttcc gtactcgtat tgcctacgtt gttcagacca acggcggtca gttcccgtat       540
     gaactgcgcg tatctgacta tgacggttac aaccagtttg tcgttcaccg ttcaccgcag       600
     ccgctgatgt ctccggcgtg gtcaccagac ggttctaaac tggcttatgt gaccttcgaa       660
     agcggtcgtt ccgcgctggt tattcagacg ctggcaaatg gcgctgtacg tcaggtggct       720
     tcattcccgc gtcacaacgg tgcacctgca ttctcgccag acggcagcaa actggcattc       780
     gccttgtcga aaaccggtag tctgaacctg tacgtaatgg atttggcttc tggtcagatc       840
     cgccaggtga ctgatggtcg cagtaacaat accgaaccga cctggttccc ggatagccag       900
     aacctggcat ttacttctga ccaggccggt cgtccgcagg tttataaagt gaatatcaac       960
     ggcggtgcgc cacaacgtat tacctgggaa ggttcgcaga accaggatgc ggatgtcagc      1020
     agcgacggta aatttatggt aatggtcagc tccaatggtg ggcagcagca cattgccaaa      1080
     caagatctgg caacgggagg cgtacaagtt ctgtcgtcca cgttcctgga tgaaacgcca      1140
     agtctggcac ctaacggcac tatggtaatc tacagctctt ctcaggggat gggatccgtg      1200
     ctgaatttgg tttctacaga tgggcgtttc aaagcgcgtc ttccggcaac tgatggacag      1260
     gtcaaattcc ctgcctggtc gccgtatctg tga                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page