(data stored in ACNUC7421 zone)

EMBL: CP001509.TOLQ

CP001509.TOLQ        Location/Qualifiers
FT   CDS_pept        733814..734506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="ECD_00697"
FT                   /product="membrane spanning protein in TolA-TolQ-TolR
FT                   complex"
FT                   /note="similar to b0737"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00697"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42572"
FT                   /protein_id="ACT42572.1"
FT                   /translation="MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAA
FT                   AREAEAFEDKFWSGIELSRLYQESQGKRDNLTGSEQIFYSGFKEFVRLHRANSHAPEAV
FT                   VEGASRAMRISMNRELENLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQAT
FT                   LQMVAPGIAEALIATAIGLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQAF
FT                   TVSESNKG"
     gtgactgaca tgaatatcct tgatttgttc ctgaaggcta gccttctggt taaacttatc        60
     atgttgattt tgattggttt ttcaatcgca tcttgggcca ttattatcca gcggacccgt       120
     attcttaacg cagcggcgcg cgaagccgaa gcgtttgaag ataaattctg gtctggaatc       180
     gaactctctc gcctctatca agagagccag gggaaacggg ataatctgac tggttcggaa       240
     caaatctttt acagcgggtt caaagagttt gtgcgcctgc atcgtgccaa tagccatgcg       300
     ccggaagccg tagtggaagg ggcgtcgcgt gctatgcgta tctccatgaa ccgtgaactt       360
     gaaaatctgg aaacgcacat tccgttcctc ggtacggttg gctccatcag cccgtatatt       420
     ggtctgtttg gtacggtctg ggggatcatg cacgccttta tcgccctcgg ggcggtaaaa       480
     caagcaacac tgcaaatggt tgcgcccggt atcgcagaag cgttgattgc gactgcaatt       540
     ggtctgtttg ccgctatccc ggcagttatg gcctacaacc gcctcaacca gcgcgtaaac       600
     aaactggaac tgaattacga caactttatg gaagagttta ccgcgattct gcaccgccag       660
     gcgtttaccg ttagcgagag caacaagggg taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page