(data stored in ACNUC7421 zone)

EMBL: CP001509.YAAI

CP001509.YAAI        Location/Qualifiers
FT   CDS_pept        complement(11380..11784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="ECD_00013"
FT                   /product="UPF0412 family protein"
FT                   /note="similar to b0013"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00013"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41915"
FT                   /protein_id="ACT41915.1"
FT                   /translation="MKSVFTISASLAISLMLCCTAQANDHKLLGVIAMPRNETNDLALK
FT                   LPVCRIVKRIQLSADHGDLQLSGASVYFKAARSASQSLNIPSEIKEGQTTDWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMATLKIIGDD"
     atgaaatccg tttttacgat ttccgccagc ctggcgatta gcctgatgct gtgctgcacg        60
     gcgcaggcaa acgaccataa actcctcggc gtcattgcaa tgccgcgtaa cgaaaccaac       120
     gatctggcgc tgaaacttcc tgtttgtcgc attgtgaaac gcatacaact ctctgccgac       180
     catggcgatt tacagttaag cggtgcatcg gtttatttca aagccgcccg tagcgccagt       240
     cagagtctga atattccttc agaaataaaa gaagggcaaa ccactgactg gatcaacatt       300
     aacagtgata acgacaataa acgctgcgtc tcaaaaatca ccttttccgg tcatacggtg       360
     aactcatcgg atatggccac gctgaaaatt atcggcgacg actaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page