(data stored in ACNUC7421 zone)

EMBL: CP001509.YAAW

CP001509.YAAW        Location/Qualifiers
FT   CDS_pept        complement(10641..11354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaW"
FT                   /locus_tag="ECD_00011"
FT                   /product="UPF0174 family protein"
FT                   /note="similar to b0011"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41913"
FT                   /protein_id="ACT41913.1"
FT                   /translation="MNVNYLNDSDLDFLQHCSEEQLANFARLLTHNEKGKTRLSSVLIR
FT                   NELFKSMEGHPEQHRRNWQLIAGELQHFGGDSIANKLRGHGKLYRAILLDVSKRLKLKA
FT                   DKEMSTFEIEQQLLEQFLRNTWKNMDEEHKQEFLHAVDARVNELEELLPLLMKDKLLAK
FT                   GVSHLLSSQLTRILRTHAAMSVLGHGLLRGAGLGGPVGAALNGVKAVSGSAYRVTIPAV
FT                   LQIACLRRMVSATQV"
     atgaatgtta attacctgaa tgattcagat ctggattttc ttcagcattg tagtgaggaa        60
     cagttggcaa atttcgcccg attgctcacc cataatgaaa aaggcaaaac tcgcctctcc       120
     agcgtactga tacgcaacga actgtttaaa tcgatggaag ggcatcccga gcaacatcgc       180
     cgcaactggc agctgattgc tggagaatta cagcattttg gtggcgatag tatcgccaac       240
     aaactgcgcg gacacggtaa attgtatcgg gccattttgc tcgatgtttc aaaacgattg       300
     aagctgaaag ccgacaaaga gatgtctacg tttgagattg agcaacagtt actggaacaa       360
     tttctgcgta acacctggaa gaatatggac gaggaacata agcaggagtt tctgcacgcg       420
     gtcgatgcca gggtgaatga gctggaagag ctgctgccgc tgctgatgaa agacaaatta       480
     ttggcaaaag gcgtgtcgca tttgctttcc agccaattga cccgcatttt acgcacccac       540
     gcagcaatga gcgtgcttgg gcatggtttg ctgcgcggcg cgggtctggg aggccctgtg       600
     ggcgcagcat taaatggggt taaagcggtc agcggcagtg cctatcgcgt gacaattcca       660
     gccgtactgc aaatcgcctg cctgcgccgg atggttagcg ccactcaggt ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page