(data stored in ACNUC7421 zone)

EMBL: CP001509.YAAX

CP001509.YAAX        Location/Qualifiers
FT   CDS_pept        5232..5528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaX"
FT                   /locus_tag="ECD_00005"
FT                   /product="DUF2502 family putative periplasmic protein"
FT                   /note="similar to b0005"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41907"
FT                   /protein_id="ACT41907.1"
FT                   /translation="MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYY
FT                   WDGGHWRDHGWWKQHYEWRGNRWHPHGPPPPPRHHKKAPHDHHGGHGPGKHHR"
     atgaaaaaga tgcaatctat cgtactcgca ctttccctgg ttctggtcgc tcccatggca        60
     gcacaggctg cggaaattac gttagtcccg tcagtaaaat tacagatagg cgatcgtgat       120
     aatcgtggct attactggga tggaggtcac tggcgcgacc acggctggtg gaaacaacat       180
     tatgaatggc gaggcaatcg ctggcaccca cacggaccgc cgccaccgcc gcgccaccat       240
     aagaaagctc ctcatgatca tcacggcggt catggtccag gcaaacatca ccgctaa          297
//

If you have problems or comments...

PBIL Back to PBIL home page