(data stored in ACNUC7421 zone)

EMBL: CP001509.YAAY

CP001509.YAAY        Location/Qualifiers
FT   CDS_pept        25253..25471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaY"
FT                   /locus_tag="ECD_00028"
FT                   /product="uncharacterized protein"
FT                   /note="similar to b0024"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41930"
FT                   /protein_id="ACT41930.1"
FT                   /translation="MCRHSLRSDGAGFYQLAGCEYSFSAIKIAAGGQFLPVICAMAMKS
FT                   HFFLISVLNRRLTLTAVQGILGRFSLF"
     atgtgccggc actcgttacg tagtgatggc gcaggattct accagcttgc ggggtgtgaa        60
     tacagctttt ccgcgataaa aattgcagca ggcggtcagt ttcttcccgt gatttgcgcc       120
     atggcaatga aaagccactt ctttctgatt tcggtactca atcgccggtt aaccttgacc       180
     gctgtacaag gtatactcgg acgattttca ctgttttga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page