(data stored in ACNUC7421 zone)

EMBL: CP001509.YABI

CP001509.YABI        Location/Qualifiers
FT   CDS_pept        74156..74920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="ECD_00067"
FT                   /product="DedA family inner membrane protein"
FT                   /note="similar to b0065"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00067"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41968"
FT                   /protein_id="ACT41968.1"
FT                   /translation="MQALLEHFITQSTVYSLMAVVLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELSFWHAWLAGIVGCLLGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAG
FT                   AAIDIPAGMQSGEFKWLLLATAVFVWVGGWLCWRLWRSGKATDRLSHYLSRGRLLWLTP
FT                   LISAIGVVALVVLIRHPLMPVYIDILRKVVGV"
     atgcaagcat tgctggaaca ctttattacc caatctaccg tgtattcatt gatggcggtg        60
     gtgttggtgg cctttctgga gtcgctggcg ctggtcggtt tgattctacc cggtacggtg       120
     ctgatggcgg ggctgggagc gctgattggc agcggcgagt taagtttctg gcacgcctgg       180
     ctggcaggga ttgtcggttg tctgctgggc gactggatct ccttctggct gggctggcgt       240
     tttaaaaagc cgttgcatcg ctggtcattt ctgaagaaaa acaaagcatt actcgataaa       300
     actgaacatg cgttgcatca acacagcatg ttcaccattc tggtcggtcg ctttgttggc       360
     ccgacgcgtc cgctggtgcc aatggtggcg ggaatgctgg atctgccggt ggcaaaattc       420
     attacgccga atattatcgg ctgcctgctg tggccaccgt tttacttcct gcctgggatt       480
     ctggcgggcg cggcgatcga tattccagcc ggaatgcaga gcggcgagtt taaatggttg       540
     ctgctggcga cggcggtatt tgtgtgggtt ggtggctggc tgtgctggcg gttatggcgc       600
     agcggtaaag caaccgatcg tttaagtcat tatttgtcgc gcggccgttt gttgtggctg       660
     acgccgttga tttctgccat cggcgtggtg gcgctggtgg tgttaattcg ccacccgttg       720
     atgccggtgt atatcgatat tttgcgtaaa gtggttgggg tttag                       765
//

If you have problems or comments...

PBIL Back to PBIL home page