(data stored in ACNUC7421 zone)

EMBL: CP001509.YACH

CP001509.YACH        Location/Qualifiers
FT   CDS_pept        complement(132212..134065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="ECD_00116"
FT                   /product="DUF3300 family protein"
FT                   /note="similar to b0117"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00116"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42017"
FT                   /protein_id="ACT42017.1"
FT                   /translation="MKMTLPFKPHVLALICSAGLCAASTGLYIKSRTVEAPVEPQSTQL
FT                   AVSDAAAVTFPATVSAPPVTPAVVKSAFSTAQIDQWVAPVALYPDALLSQVLMASTYPT
FT                   NVAQAVQWSHDNPLKQGDAAIQAVSDQPWDASVKSLVAFPQLMALMGENPQWVQNLGDA
FT                   FLAQPQDVMDSVQRLRQLAQQTGSLKSSTEQKVITTTKKAVPVKQTVTAPVIPSNTVLT
FT                   ANPVITEPATTVISIEPANPDVVYIPNYNPTVVYGNWANTAYPPVYLPPPAGEPFVDSF
FT                   VRGFGYSMGVATTYALFSSIDWDDDDHDHHHHDDDDYHHHDGGHRDGNGWQHNGDNINI
FT                   DVNNFNRITGEHLTDKNMAWRHNPNYRNGVPYHDQDMAKRFHQTDVNGGMSATQLPAPT
FT                   RDSQRQAAANQFQQRTHAAPVITRDTQRQAAAQRFNEAEHYGSYDDFHDFSRRQPLTQQ
FT                   QKDAARQRYQSASPEQRQAVRERMQTNPKIQQRREAARERIQSASPEQRQAVREKMQTN
FT                   PQNQQRRDAARERIQSASPEQRQVFKEKVQQRPLNQQQRDNARQRVQSASPEQRQVFRE
FT                   KVQESRPQRLNDSNHTVRLNNEQRSAVRERLSERGARRLER"
     atgaaaatga ctttgccgtt taaaccccat gtgctggcgc taatttgcag tgccgggctt        60
     tgtgccgcct ctaccgggct atatataaaa agccgcacag tggaagcgcc tgtggaaccg       120
     caatcgacac aactggctgt gtctgacgct gccgcggtta cgtttcctgc aacggtttcc       180
     gcacctcccg taacacccgc cgtcgtcaaa tccgcattca gcactgcaca aatagatcaa       240
     tgggtcgcgc ccgtcgcgct gtatcccgac gccctacttt cgcaggtgct gatggcatca       300
     acctatccga caaacgttgc tcaagcagtg caatggtcgc acgataatcc acttaaacaa       360
     ggcgatgctg ctattcaggc ggtatctgac cagccgtggg acgccagcgt taaatcactg       420
     gtggcctttc cacaattgat ggcattgatg ggcgaaaacc cgcaatgggt gcaaaacctg       480
     ggcgatgctt ttctggccca gccgcaggac gtgatggact cggtacagcg attgcggcaa       540
     ctggcgcaac aaaccggctc gctgaagtca tcaaccgaac agaaagttat taccacaacg       600
     aagaaagctg taccggtaaa acagacagtc acggcacccg tcataccatc caatacagtt       660
     ttaactgcca accccgtcat tacagagccg gcaacaaccg tcatttccat tgagcccgcc       720
     aatcctgatg tggtctatat tcccaactac aacccaaccg tggtttacgg gaactgggcc       780
     aatactgcgt atccgccggt ttatctgcca ccaccagccg gagaaccgtt tgttgacagc       840
     tttgtacgcg gattcggcta tagcatgggc gttgctacca cgtacgcact attcagcagc       900
     atcgactggg acgacgacga tcatgaccat catcatcatg acgatgatga ttatcatcac       960
     cacgatggcg gtcatcgtga cggtaatggc tggcaacaca acggcgacaa catcaatatc      1020
     gacgtcaaca atttcaaccg tatcaccggt gagcatctta ctgataagaa tatggcatgg      1080
     cggcacaatc caaactaccg taatggtgtg ccctatcatg atcaggatat ggcaaagcgg      1140
     tttcatcaaa ccgatgtcaa cggcggaatg agcgccacgc aattacctgc cccaacgcgc      1200
     gacagccagc gtcaggcggc agcaaatcag tttcagcaac gaacacacgc cgcaccagtc      1260
     attacacgag atacccaacg tcaggcagcg gcacagcggt ttaatgaagc tgaacactat      1320
     gggagctatg acgacttcca cgacttcagc cgtcgccaac cactgaccca gcaacaaaag      1380
     gacgccgctc gtcagcgtta tcagtccgcc tcgcctgagc agcgccaggc agttcgcgag      1440
     agaatgcaga ctaacccgaa gatccagcag cgaagagagg cagcgcgtga gcgcattcag      1500
     tccgcctcgc ctgagcagcg ccaggcggtt cgcgagaaaa tgcagactaa cccgcagaac      1560
     cagcagcgaa gagacgcagc gcgtgagcgt attcagtccg catcaccaga gcagcgccag      1620
     gtgtttaagg aaaaagtaca gcagcgccca ctgaatcaac agcaacgtga taacgcccgc      1680
     cagcgtgttc aatcggcatc acctgaacaa cgtcaggttt ttcgggagaa agttcaggag      1740
     agccgcccac aacgtctaaa cgacagtaac catactgtca ggctgaataa cgagcaacgg      1800
     tcagcagtac gcgaacgtct ctctgaacgt ggagcaagaa gactggaaag gtaa            1854
//

If you have problems or comments...

PBIL Back to PBIL home page