(data stored in ACNUC7421 zone)

EMBL: CP001509.YADC

CP001509.YADC        Location/Qualifiers
FT   CDS_pept        complement(152518..153864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadC"
FT                   /locus_tag="ECD_00134"
FT                   /product="putative fimbrial-like adhesin protein"
FT                   /note="similar to b0135"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00134"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42035"
FT                   /protein_id="ACT42035.1"
FT                   /translation="MMCTTNNRSKQITATVTAVDGGVIMKKFFRHFLFLILCLSCYTAS
FT                   AGTDDNVGYIVGNSYGVGPSDQKWRETGPNGDATVIFRYATSTNNLVFYKPTQLGPTGV
FT                   KLQWSQLDTASGGGFLYCNRSDSTSGSAMRIENAMVDSGKMYGSHKLFNTSVPGLYYTL
FT                   LISNMWSAYGTVTNVSSPGIYIGDSAEQYFSWYNPSEDVLYWSCNNANSTRKYWAVGGI
FT                   YQTLTIEFYTDTNFDPTVTQQIKLSSSSNYLYSFKAYGAGQGINEHSYFIKIDFDLLNV
FT                   KLTNPTCFTAMLSGTSVTGSTVKMGEYSAEQIRNGATPVPFDISLQNCVRVTNIETKLV
FT                   STKVGTENGQLLGNTLTGNDAAKGVGVLIEGLATSKNPLMTLKPNDSNSVYKDYDPRGK
FT                   DDTTGGVYPDQDTGITYPLHFQATLQQDGTIPIEAGEFKATSTFQVTYP"
     ttgatgtgta ctacgaataa tagatcaaaa caaataactg cgactgttac agcagtagat        60
     ggtggagtga taatgaagaa attcttcaga cattttcttt ttttaattct gtgcttgagt       120
     tgttataccg cgagtgctgg cactgatgat aacgtaggat atattgttgg gaatagttac       180
     ggcgttggtc cgtcagatca aaaatggaga gaaacggggc cgaatggcga tgctactgtc       240
     atattcagat atgcaacaag tacaaataat ttagttttct acaaaccgac gcagcttgga       300
     cctacaggtg taaaattaca gtggagtcag ttagataccg cttctggtgg tggttttctt       360
     tattgcaaca gaagtgatag cacaagtggt agcgcaatgc gtattgaaaa tgcaatggtt       420
     gactcaggta aaatgtatgg ctcccataaa ttatttaata catcagttcc tggtttgtat       480
     tacacattat taatttcaaa catgtggtca gcttacggta ccgtaactaa cgttagttca       540
     cctgggatat acattggtga ctctgcagaa caatattttt cgtggtataa tccaagcgaa       600
     gacgtgttat attggagttg caataatgcg aatagcaccc gtaaatactg ggctgtaggt       660
     ggtatttatc agacccttac aattgaattc tatacagata caaactttga tccaacagta       720
     actcaacaga tcaaattatc cagctcatca aattatctgt attcatttaa agcctatggc       780
     gcaggccaag gtataaatga gcatagttat tttatcaaaa tcgatttcga tctgctcaat       840
     gtcaagttga ctaatcccac ttgttttacc gctatgctta gtggaacttc tgtgactggt       900
     tctacggtaa aaatgggtga atatagtgca gaacaaatca gaaacggtgc cacaccggtt       960
     ccttttgata tttcacttca aaactgcgtt cgtgtgacta atattgagac aaaattagtt      1020
     tcaacaaagg ttggtactga aaacgggcaa ctccttggta atactctcac aggtaatgac      1080
     gcagcaaaag gagtcggtgt actcatagaa ggtttagcaa ctagtaaaaa tcctctaatg      1140
     acattgaaac ctaatgattc aaattctgtt tataaagatt acgacccgag aggcaaagac      1200
     gatacaacag gaggagttta cccggatcaa gatacaggta taacataccc tctccatttc      1260
     caggccacgc tacaacagga tggaactata ccaatagaag ctggtgagtt taaagccacc      1320
     agtactttcc aggtaaccta cccttaa                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page