(data stored in ACNUC7421 zone)

EMBL: CP001509.YADI

CP001509.YADI        Location/Qualifiers
FT   CDS_pept        147381..147821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="ECD_00128"
FT                   /product="putative PTS Enzyme IIA"
FT                   /note="similar to b0129"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42029"
FT                   /protein_id="ACT42029.1"
FT                   /translation="MLGWVITCHDDRAQEMLDALEKKHGALLQCRAVNFWRGLSSNMLS
FT                   RMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACR
FT                   ETMTSSEFRERIVELGAPEVSSLWHQQQKNPPFVLKHNLYEY"
     atgttaggtt gggtaattac ctgtcacgat gaccgggcgc aagagatgct ggatgcgctg        60
     gagaaaaaac atggggcact tcttcagtgc cgggccgtga atttctggcg cggattaagc       120
     tctaatatgc tcagccgcat gatgtgcgat gctctgcatg aagcggactc tggtgagggt       180
     gtcatcttct taaccgatat agccggagcg ccaccgtatc gcgtggcttc attattaagc       240
     cacaaacact cccgttgcga agtgatttct ggtgtcacgt taccgttaat tgaacagatg       300
     atggcttgcc gtgaaaccat gaccagttca gagtttcgcg agcgtattgt cgaactgggt       360
     gcgccggagg tgagtagtct ttggcaccaa caacaaaaaa atccgccttt cgtcctcaaa       420
     cataatttgt atgagtatta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page