(data stored in ACNUC7421 zone)

EMBL: CP001509.YADK

CP001509.YADK        Location/Qualifiers
FT   CDS_pept        complement(153845..154441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadK"
FT                   /locus_tag="ECD_00135"
FT                   /product="putative fimbrial-like adhesin protein"
FT                   /note="similar to b0136"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42036"
FT                   /protein_id="ACT42036.1"
FT                   /translation="MHPTQRKLMKRIILFLSLQFPITYPAIAGQDIDLVANVKNSTCKS
FT                   GISNQGNIDLGVVGVGYFSDNVTPESYQPGGKEFTVTVSDCALQGTGDVLNQLHIDFRA
FT                   LSGVMAAGSRQIFANEVATGAKNVGVVLFSIQDPTNIFNVISSAGNSRSVYPVMTSALH
FT                   NSSWKFYARMQKIDPALDVISGQVMSHILVDVYYE"
     atgcatccca ctcaacgtaa gctgatgaag agaataattc tgtttctgtc actacagttt        60
     cccattacct atccagccat cgctgggcag gatattgacc ttgttgccaa tgtaaaaaac       120
     agcacttgca aaagcggaat cagtaaccag ggtaatattg atcttggcgt cgttggggtg       180
     ggatattttt cagataatgt tactcctgaa agctatcaac caggtggaaa agagttcact       240
     gtcacagtat cagactgtgc attacaggga actggcgatg tgcttaatca gttacatatt       300
     gattttagag cccttagcgg tgtcatggct gcaggttcaa ggcaaatatt tgccaatgaa       360
     gtcgcaaccg gggctaaaaa tgtcggtgtc gttctctttt ccattcagga cccgaccaat       420
     atattcaatg ttattagttc agcaggaaat tctcgttccg tgtatccagt aatgacttct       480
     gccctgcata attcttcatg gaaattttat gccagaatgc aaaaaatcga tcccgcgctg       540
     gatgtcatat ctggccaggt aatgagtcat atattagttg atgtgtacta cgaataa          597
//

If you have problems or comments...

PBIL Back to PBIL home page