(data stored in ACNUC7421 zone)

EMBL: CP001509.YADL

CP001509.YADL        Location/Qualifiers
FT   CDS_pept        complement(154468..155070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadL"
FT                   /locus_tag="ECD_00136"
FT                   /product="putative fimbrial-like adhesin protein"
FT                   /note="similar to b0137"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00136"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42037"
FT                   /protein_id="ACT42037.1"
FT                   /translation="MTFKNLRYGLSSSVVLAASLFSVPSYAATDSIGLTVITTVEIGTC
FT                   TATLVNDSDQDISVVDFGDVYISEINAKTKVKTFKLKFKDCAGIPNKKAQIKLTKRATC
FT                   EGTANDGAGFANGSTAADKASAVAVEVWSTETPATGSATQFSCVTPASQEVTISNAANA
FT                   VVYYPMSARLVVEKNKTVSNVTAGKFSAPATFTVTYN"
     atgacattta aaaatttacg ttatggatta tccagcagtg tcgttttggc tgcctcattg        60
     ttcagcgtac cctcttatgc ggcaacagac agcattgggc tgaccgtgat tactaccgta       120
     gaaataggta cttgtaccgc tacattagta aatgactctg atcaggacat ttctgttgtt       180
     gactttggcg atgtatatat ttctgaaatc aatgccaaga ccaaagttaa aacattcaaa       240
     ctcaaattca aagactgtgc gggtatcccc aataaaaaag cacaaataaa attaaccaag       300
     cgagccacat gcgaaggtac tgctaatgac ggtgcggggt tcgcaaatgg atccacagcc       360
     gcagataaag caagtgccgt cgccgttgaa gtctggagca ccgaaactcc ggcaacaggg       420
     agcgcaacac aatttagttg tgtgacacca gcatctcaag aggtcactat ctccaatgca       480
     gccaacgcgg ttgtttatta tccgatgagt gctcgactgg tcgtcgaaaa aaataaaacc       540
     gtaagcaatg tcactgcggg taaattttct gcacctgcca catttacagt aacctataac       600
     taa                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page