(data stored in ACNUC7421 zone)

EMBL: CP001509.YADN

CP001509.YADN        Location/Qualifiers
FT   CDS_pept        complement(159151..159735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadN"
FT                   /locus_tag="ECD_00140"
FT                   /product="putative fimbrial-like adhesin protein"
FT                   /note="similar to b0141"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42041"
FT                   /protein_id="ACT42041.1"
FT                   /translation="MSKKLGFALSGLMLAMVAGTASADMDGGQLNISGLVVDNTCETRV
FT                   DGGNKDGLILLQTATVGETDAGVLNDTVGAKAKPFSITVDCSKANPNPGSTAKMTFGSV
FT                   FFGNSKGTLNNDMSINNPSDGVNIALHNIDGSTIKQVQINNPGDVYTKALDATTKSAVY
FT                   DFKASYVRAVADQTATAGYVKTNTAYTITYQ"
     atgtctaaaa aattaggttt tgccctgtct ggtcttatgc tggcaatggt tgcaggtact        60
     gcttctgctg atatggatgg tggtcagtta aatatcagtg gtctggttgt tgataacacc       120
     tgtgaaaccc gcgttgacgg cggtaataaa gatggtctga tcctgctgca aactgcaact       180
     gttggtgaaa ccgatgctgg cgtgctgaat gacaccgttg gcgctaaagc caaacctttc       240
     agcatcaccg ttgactgcag caaagcaaat ccgaatccag gtagtacagc taaaatgacc       300
     ttcggttctg ttttctttgg taatagcaaa ggaacgctga acaacgacat gtctattaac       360
     aacccatctg acggcgttaa tatcgctctg cacaatattg atggttccac tatcaaacag       420
     gttcaaatta acaaccctgg cgatgtgtat actaaagccc tggatgcaac gacaaaatct       480
     gctgtttatg attttaaagc gtcttacgtt cgtgccgtcg cagaccaaac agcaactgct       540
     ggttatgtaa aaactaacac tgcatacacc attacttatc agtaa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page