(data stored in ACNUC7421 zone)

EMBL: CP001509.YADS

CP001509.YADS        Location/Qualifiers
FT   CDS_pept        complement(179844..180467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadS"
FT                   /locus_tag="ECD_00156"
FT                   /product="UPF0126 family inner membrane protein"
FT                   /note="similar to b0157"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00156"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42057"
FT                   /protein_id="ACT42057.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDHGPVFWVKDPTDLVVAMVTSMLTIVLVRQPRRLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFNAEAGPLIAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AYYTFSVPLETASMMGMVVTLLIRLAAIRWHLKLPTFALDENGR"
     atgctcgtct attggctgga tatagtcggc acagcggtat ttgccatctc cggcgttttg        60
     ttagccggaa aattgcgtat ggaccctttt ggtgttctgg tactgggcgt ggttaccgct       120
     gtaggcggcg ggacaattcg cgacatggcg ctggatcacg gcccggtatt ttgggtgaaa       180
     gatcccaccg atctggtcgt tgcaatggtc accagcatgc tgaccatcgt gctggtgcgc       240
     cagccaagac gcttaccaaa atggatgttg ccggtgctgg acgccgttgg tctggcggtg       300
     tttgtcggca ttggcgtgaa taaagccttt aatgcggaag ccggtccgtt aatcgcggtt       360
     tgtatgggcg tcattactgg cgttggcggc gggatcattc gtgatgttct ggcccgcgaa       420
     atccccatga ttttacgtac agaaatctac gcaactgcct gtattatcgg cggtattgtc       480
     cacgctacgg cttattacac attttccgta ccactggaaa cagccagtat gatgggcatg       540
     gtcgtgacgc tattgattcg gctggcggct attcgttggc atcttaagct accgacgttt       600
     gcgctggatg agaatgggcg ttga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page