(data stored in ACNUC7421 zone)

EMBL: CP001509.YAEH

CP001509.YAEH        Location/Qualifiers
FT   CDS_pept        complement(186552..186938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="ECD_00162"
FT                   /product="UPF0325 family protein"
FT                   /note="similar to b0163"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00162"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42063"
FT                   /protein_id="ACT42063.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDKGEFFAKS
FT                   VKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYIIDELDQICQRDRSEVDLKRKILDDL
FT                   RHLESVVTNKISEIEADLEKLTRK"
     atgtacgaca atctgaaaag tctgggtatt accaatcctg aagaaattga tcgttacagc        60
     ctccggcagg aagccaacaa cgatattctg aaaatctatt tccagaaaga caaaggcgag       120
     tttttcgcca agagcgttaa gtttaaatat ccgcgtcagc gtaaaacggt cgtcgctgat       180
     ggtgtgggtc agggttataa agaagtccag gaaatcagcc cgaatctacg gtatatcatt       240
     gatgagcttg atcaaatctg ccagcgtgac cgcagcgaag ttgatcttaa gcgtaagatc       300
     ctcgacgact tacgtcacct ggagtcagtc gtaaccaata agatcagcga gattgaagcc       360
     gatctggaaa aactaacgcg taaataa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page