(data stored in ACNUC7421 zone)

EMBL: CP001509.YAEI

CP001509.YAEI        Location/Qualifiers
FT   CDS_pept        complement(187100..187912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeI"
FT                   /locus_tag="ECD_00163"
FT                   /product="phosphodiesterase with model substrate bis-pNPP"
FT                   /note="similar to b0164"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00163"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42064"
FT                   /protein_id="ACT42064.1"
FT                   /translation="MISRRCLLLAAAATLTAGSGFGYMRYWEPGWLELTHQRIAFFKDK
FT                   AAPFKILFLADLHYSRFVPLSLISDAIALGIEQKPDLILLGGDYVLFDMPLNFSAFSNV
FT                   LSPLAECAPTFACFGNHDRPVGTEKNHLIGETLKSVGITVLFNQATVIATPNRQFELVG
FT                   TGDLWAGQCKPPPASEANLPRLMLAHNPDSKEVMRDEPWDLMLCGHTHGGQLRVPLVGE
FT                   PFAPVEDKRYVAGLNAFGERHIYTTRGVGSLYGLRLNCRPEVTMLELV"
     atgatttcac gcagatgttt gttactggct gccgccgcaa cgttaactgc cggatcaggc        60
     ttcggctata tgcgttattg ggaaccaggt tggctcgaat taacccatca gcgcatcgcc       120
     ttttttaaag acaaagccgc acccttcaaa attctttttc tggcagatct ccattactct       180
     cgttttgttc ctttaagcct aatttctgac gcgattgctc ttggcataga acaaaagccc       240
     gatttgatat tgctgggcgg cgactacgta ttatttgata tgccgctgaa tttttcggcg       300
     tttagtaacg tactctctcc ccttgccgaa tgtgcgccga cgtttgcctg cttcggcaac       360
     cacgatcgcc ctgttggtac agaaaaaaat cacttaattg gcgagacgtt gaaatcagtg       420
     ggcatcacgg tgttgtttaa ccaggctacg gtgatcgcca cgccgaacag gcaattcgaa       480
     ctggtaggca ccggtgactt atgggccgga caatgcaaac cacctcccgc cagcgaagca       540
     aatctgccaa gactgatgct ggcacataat cccgacagca aagaagtcat gcgtgatgaa       600
     ccctgggatc tgatgctgtg cggccatact cacggcgggc aactgcgcgt accgttggtt       660
     ggtgaacctt ttgcccctgt cgaagataaa cgttacgtcg ccggattaaa tgcctttggc       720
     gaacgacaca tctacacaac ccgtggcgtg ggcagtttgt atggtttgcg tctgaactgc       780
     cgcccggaag taacgatgct ggaactggtg tag                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page