(data stored in ACNUC7421 zone)

EMBL: CP001509.YAEP

CP001509.YAEP        Location/Qualifiers
FT   CDS_pept        complement(216768..216968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeP"
FT                   /locus_tag="ECD_00188"
FT                   /product="UPF0253 family protein"
FT                   /note="similar to b4406"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00188"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42089"
FT                   /protein_id="ACT42089.1"
FT                   /translation="MEKYCELIRKRYAEIASGDLGYVPDALGCVLKVLNEMAADDALSE
FT                   AVREKAAYAAANLLVSDYVNE"
     gtggaaaaat attgtgagtt aatacgcaag cggtacgcgg aaatcgccag cggagactta        60
     ggatacgttc cggacgcgct gggctgcgtt ttgaaagtgc tgaatgaaat ggctgccgac       120
     gacgcccttt ctgaggctgt cagggaaaaa gcagcatacg ctgcggcaaa cttactggtg       180
     agcgattatg tcaatgaatg a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page