(data stored in ACNUC7421 zone)

EMBL: CP001509.YAFJ

CP001509.YAFJ        Location/Qualifiers
FT   CDS_pept        248901..249668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafJ"
FT                   /locus_tag="ECD_00218"
FT                   /product="type 2 glutamine amidotransferase family protein"
FT                   /note="similar to b0223"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00218"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42119"
FT                   /protein_id="ACT42119.1"
FT                   /translation="MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKG
FT                   CRTFKDPQPSFNSPIAKLVQDYPIKSCSVVAHIRQANRGEVALENTHPFTRELWGRNWT
FT                   YAHNGQLTGYKSLETGNFRPVGETDSEKAFCWLLHKLTQRYPRTPGNMAAVFKYIASLA
FT                   DELRAKGVFNMLLSDGRYVMAYCSTNLHWITRRAPFGVATLLDQDVEIDFSSQTTPNDV
FT                   VTVIATQPLTGNETWQKIMPGEWRLFCLGERVV"
     atgtgcgaat tgctcgggat gagcgccaac gtccctaccg atatctgctt tagtttcacc        60
     gggcttgtac agcgtggtgg tggaaccggg ccacataaag atggctgggg cattaccttt       120
     tacgaaggta aaggctgtcg cacatttaaa gatccacaac ccagctttaa ttcccccatc       180
     gccaaacttg tccaggacta cccgataaaa tcctgttcgg tggtggctca tattcgccag       240
     gctaatcggg gcgaggtggc gctggaaaat actcacccgt ttacccgcga gttatggggg       300
     cgtaactgga cttatgccca taacgggcaa ctgacgggct acaaatcact ggaaaccggc       360
     aacttccgcc cggtcggtga aaccgacagc gaaaaagcct tttgctggct cctgcataaa       420
     ttaacgcagc gttacccgcg cacgccgggc aacatggcgg cagtgtttaa atatatcgcc       480
     tcactggcgg atgaactgcg ggcgaagggc gttttcaaca tgctgctttc ggacggtcgc       540
     tatgtaatgg cgtattgctc gactaattta cactggatca cccgccgcgc gccgtttggc       600
     gtggcaacgt tgctggatca ggatgtggaa atcgacttca gctcgcagac cacaccgaat       660
     gatgtggtca cggtgattgc gacacagccg ctgacgggca atgaaacctg gcaaaaaatt       720
     atgccaggcg aatggcgctt attttgcctc ggggagcgtg tagtttga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page