(data stored in ACNUC7421 zone)

EMBL: CP001509.YAGU

CP001509.YAGU        Location/Qualifiers
FT   CDS_pept        273177..273791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagU"
FT                   /locus_tag="ECD_00246"
FT                   /product="DUF1440 family inner membrane acid resistance
FT                   protein"
FT                   /note="similar to b0287"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00246"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42145"
FT                   /protein_id="ACT42145.1"
FT                   /translation="MNIFEQTPPNRRRYGLAAFIGLIAGVVSAFVKWGAEVPLPPRSPV
FT                   DMFNAACGPESLIRAAGQIDCSRNFLNPPYIFLRDWLGLTDPNAAVYTFAGHVFNWVGV
FT                   THIIFSIVFAVGYCVVAEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPPLFDLPWY
FT                   ENVSEIFGHLVWFWSIEIIRRDLRNRITHEPDPEIPLGSNR"
     atgaatatat ttgaacaaac tccaccgaac cgcagacgtt atggtcttgc tgcattcatt        60
     gggctgattg ctggcgttgt ttccgcattt gtgaagtggg gggctgaagt tccattgccg       120
     ccacgtagcc cggtggatat gtttaatgca gcgtgtggcc cggaatcatt aatcagggct       180
     gctgggcaaa ttgattgctc gcgtaatttt ctcaatcctc cgtatatttt tcttcgagac       240
     tggctggggc tgacagatcc caatgcggct gtttatacct ttgccgggca tgtctttaac       300
     tgggttggtg ttacgcacat tatcttttcg atagtgtttg ctgtcggtta ttgtgtggtc       360
     gctgaagtat ttccaaaaat taaactctgg cagggcttac tggcaggtgc tttagcccaa       420
     ctttttgttc atatgatttc tttccctctc atgggactga caccacctct gtttgatctt       480
     ccgtggtatg agaatgtctc tgaaattttt ggacatttag tctggttctg gtctattgaa       540
     attattcgca gagatttacg aaacagaatt actcatgagc cagaccctga gatcccttta       600
     ggctcaaaca gataa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page