(data stored in ACNUC7421 zone)

EMBL: CP001509.YAHD

CP001509.YAHD        Location/Qualifiers
FT   CDS_pept        304908..305513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahD"
FT                   /locus_tag="ECD_00274"
FT                   /product="ankyrin repeat protein"
FT                   /note="similar to b0318"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42173"
FT                   /protein_id="ACT42173.1"
FT                   /translation="MSIKNLPADYLLAAQQGDIDKVKTCLALGVDINTCDRQGKTAITL
FT                   ASLYQQYACVQALIDAGADINKQDHTCLNPFLISCLNDDLTLLRIILPAKPDLNCVTRF
FT                   GGVGLTPACEKGHLSIVKELLAHTEINVNQTNHVGWTPLLEAIVLNDGGIKQQAIVQLL
FT                   LEHGASPHLTDKYGKTPLELARERGFEEIAQLLIAAGA"
     atgagtataa aaaatctacc tgccgactat ttattggctg cacaacaggg tgatatcgat        60
     aaagtaaaaa cctgccttgc gctgggtgtc gatattaata cctgcgatcg tcaggggaaa       120
     acggcaatta cgctggcaag tttatatcag caatatgctt gcgttcaggc attaattgat       180
     gccggagcgg atattaataa gcaagatcat acctgtttaa atcctttttt aattagctgt       240
     ctgaacgatg atttaacgct actacgaatt attttaccgg ctaaacccga tcttaattgc       300
     gtaacccgtt ttggcggtgt cggcctgacg cctgcctgtg aaaaaggcca tttaagtatt       360
     gtaaaagagc ttttggcgca tacggagatt aacgttaacc agaccaacca tgtaggctgg       420
     acgccgctac tggaagcgat tgtgcttaat gatggtggta ttaaacagca ggcgattgtg       480
     cagttattgc tggaacacgg tgccagcccg catctgaccg ataaatatgg caaaacgcca       540
     ctggaactgg cgcgggaacg gggctttgaa gagattgcgc agttactgat tgccgcaggt       600
     gcataa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page