(data stored in ACNUC7421 zone)

EMBL: CP001509.YAHE

CP001509.YAHE        Location/Qualifiers
FT   CDS_pept        305553..306416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahE"
FT                   /locus_tag="ECD_00275"
FT                   /product="DUF2877 family protein"
FT                   /note="similar to b0319"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42174"
FT                   /protein_id="ACT42174.1"
FT                   /translation="MWALTADADFLAQRGQGQVEQVFARAVNIALPARQQLLTLLCEEY
FT                   DNAPNSCRLALTHFDDLFRHGDKVQFDDQGITVGQHLHIEMSRCRRWLSPTLQMTAVNF
FT                   HLIAWQQWHDIIHQHLGENETLFNYRGDNPFYQALNKELHIKRRAVIQAVNEKQNIAAA
FT                   VASMMGLGIGLTPSADDYLTGLVLILFISGHPAEKYKEEFYRGLQRGRNNTTLLSAITL
FT                   EAALQQRCRENIHHFIHDIIYGVPGNSTQAIEKIKHIGSSSGCDMLYGMADGCALSQTY
FT                   GGNYVS"
     gtgtgggcgc taactgcgga tgcggatttt ctggcgcagc gggggcaagg acaggttgaa        60
     caggtctttg ccagagcggt aaatatcgca ctcccggctc gccagcagtt gctgacgctg       120
     ctttgtgaag agtacgacaa tgcgccaaac agttgtcggt tggcactcac tcactttgat       180
     gatctgttcc ggcatggtga taaggttcag tttgacgatc aaggtattac ggttggtcaa       240
     catcttcata tagagatgag tcgttgtcgg cgttggctgt ccccaacctt gcaaatgacc       300
     gctgtgaatt ttcaccttat cgcctggcaa cagtggcacg acattattca tcagcacctg       360
     ggggaaaatg aaaccctgtt taattatcgc ggcgataatc cgttttatca ggcgttaaat       420
     aaagaactac atattaaacg acgggcagtt attcaggcag taaacgaaaa acaaaatatc       480
     gccgcagcgg tcgccagtat gatggggtta gggattggcc ttacgccatc agccgatgat       540
     tatctgaccg gactggtact tattttattt atttccgggc atccggcgga aaaatacaaa       600
     gaggaatttt atcgcggtct gcaacgcggc agaaataata ccacattatt aagtgccata       660
     acgctggaag ccgcattaca acaacgctgc cgggaaaata ttcatcattt tattcacgat       720
     attatttatg gcgtccctgg gaattcaact caggcaatag aaaaaattaa acatattggc       780
     tccagttccg gctgcgacat gctgtatggc atggccgatg gttgtgcgct gagccaaacc       840
     tacggaggga attatgtcag ttaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page