(data stored in ACNUC7421 zone)

EMBL: CP001509.YAHG

CP001509.YAHG        Location/Qualifiers
FT   CDS_pept        307953..309371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahG"
FT                   /locus_tag="ECD_00277"
FT                   /product="DUF1116 family protein"
FT                   /note="similar to b0321"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00277"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42176"
FT                   /protein_id="ACT42176.1"
FT                   /translation="MSQSLFSQPLNVINVGIAMFSDDLKKQHVEVTQLDWTPPGQGNMQ
FT                   VVQALDNIADSPLADKIAAANQQALERIIQSHPVLIGFDQAINVVPGMTPKTILHAGPP
FT                   ITWEKMCGAMKGAVTGALVFEGLAKDLDEATELAASGEITFSPCHEHDCVGSMAGVTSA
FT                   SMFMHIVKNKTYGNIAYTNMSEQMAKILRMGANDQSVIDRLNWMRDVQGPILRDAMKII
FT                   GEIDLRLMLAQALHMGDECHNRNNAGTTLLIQALTPGIIQAGYSVEQQREVFEFVASSD
FT                   YFSGPTWMAMCKAAMDAAHGIEYSTVVTTMARNGVEFGLRVSGLPGQWFTGPAQQVIGP
FT                   MFAGYKPEDSGLDIGDSAITETYGIGGFAMATAPAIVALVGGTVEEAIDFSRQMREITL
FT                   GENPNVTIPLLGFMGVPSAIDITRVGSSGILPVINTAIAHKDAGVGMIGAGIVHPPFAC
FT                   FEKAILGWCERYGV"
     atgagccagt cactgtttag ccaaccgttg aacgttatta acgtcggtat cgccatgttt        60
     agcgatgacc tgaaaaagca gcatgtagaa gtgactcaac tcgactggac gccgccgggg       120
     cagggcaata tgcaggtggt gcaggcgctg gataacattg ccgattcgcc gctggcagac       180
     aaaatcgccg ccgctaacca gcaggcgctg gagcgcatta tccagtcgca tccggtgctg       240
     attggttttg atcaggcgat taacgtggtg ccgggcatga cgccgaaaac cattcttcac       300
     gccgggccgc cgatcacctg ggaaaaaatg tgcggcgcga tgaaaggcgc ggtcaccggg       360
     gcgttggtgt tcgaagggct ggcgaaagat ctcgatgagg cgactgaact ggcggcctcc       420
     ggggagatca ccttctcgcc gtgccacgaa cacgactgcg tgggatcgat ggcgggcgtt       480
     acctcggcct cgatgtttat gcacatcgtg aaaaacaaaa cctacggcaa catcgcttat       540
     accaatatga gcgagcagat ggcgaagatt ttgcgtatgg gtgctaacga ccagagcgtg       600
     attgaccgcc tgaactggat gcgtgatgtg cagggaccaa tactgcgcga cgcgatgaaa       660
     attatcggcg aaatcgatct gcgcttaatg ctggcgcagg cgctgcatat gggcgatgag       720
     tgccataacc gcaataacgc cgggacgaca ctgctgattc aggcgctgac gccggggatt       780
     attcaggcgg gttattccgt cgagcaacag cgcgaagtgt ttgagtttgt cgccagcagc       840
     gactacttct ccggcccgac gtggatggcg atgtgtaaag cggcgatgga tgcggcgcat       900
     ggcatcgaat acagcaccgt ggtcaccacc atggcgcgta acggcgtcga gttcggcctg       960
     cgggtcagcg gcctgccggg gcaatggttt accggcccgg cgcagcaggt gatcggcccg      1020
     atgtttgccg gttataagcc ggaagattcg gggctggata tcggcgacag cgccatcacc      1080
     gaaacctacg gtattggcgg atttgctatg gcgaccgcgc ccgctatcgt cgcgctggtg      1140
     ggcggcacgg tggaagaagc tattgatttc tcccgtcaga tgcgcgaaat caccctcggt      1200
     gaaaacccca acgtcaccat tccgctgctc ggttttatgg gcgtgccgtc ggcaatcgac      1260
     atcacccgcg tgggtagcag cggcattctg ccggtgatca acaccgccat cgcccataaa      1320
     gatgcgggcg tcggcatgat tggcgcgggc attgtgcatc caccttttgc ctgcttcgag      1380
     aaagccattc ttggctggtg cgaacgttac ggcgtctga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page