(data stored in ACNUC7421 zone)

EMBL: CP001509.YAHI

CP001509.YAHI        Location/Qualifiers
FT   CDS_pept        309793..310743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahI"
FT                   /locus_tag="ECD_00278"
FT                   /product="carbamate kinase-like protein"
FT                   /note="similar to b0323"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00278"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42177"
FT                   /protein_id="ACT42177.1"
FT                   /translation="MKELVVVAIGGNSIIKDNASQSIEHQAEAVKAVADTVLEMLASDY
FT                   DIVLTHGNGPQVGLDLRRAEIAHEREGLPLTPLANCVADTQGGIGYLIQQALNNRLARH
FT                   GEKKAVTVVTQVEVDKNDPGFAHPTKPIGAFFSDSQRDELQKANPDWCFVEDAGRGYRR
FT                   VVASPEPKRIVEAPAIKALIQQGFVVIGAGGGGIPVVRTDAGDYQSVDAVIDKDPSTAL
FT                   LAREIHADILVITTGVEKVCIHFGKPQQQALDRVDIATMTRYMQEGHFPPGSMLPKIIA
FT                   SLTFLEQGGKEVIITTPECLPAALRGETGTHIIKT"
     atgaaagagc ttgtggtcgt tgccattggt ggcaacagca ttatcaaaga taacgccagc        60
     cagtcgattg agcatcaggc ggaggcggtg aaagccgtcg ccgatacggt gctggaaatg       120
     ctggcttccg attacgacat tgtgctgacc cacggcaacg ggccgcaggt cgggctggat       180
     ttacgccgtg cggagattgc ccacgagcgc gaagggctgc ccttaacgcc gctggcgaac       240
     tgtgtggcag atacgcaggg cggcatcggc tatctgatcc aacaggcgct gaataaccgg       300
     ctggcgcgtc acggcgagaa gaaagccgtc accgtggtga ctcaggtgga agtggataaa       360
     aacgatccag gttttgccca tcccaccaag cccatcggcg cattctttag tgacagccag       420
     cgtgacgaat tacaaaaggc aaaccctgac tggtgttttg ttgaagatgc cgggcggggc       480
     tatcgccgcg tggtcgcctc gccggaaccg aaacgtattg tcgaagcacc tgccattaaa       540
     gcgctgatcc aacaaggttt tgtcgtaatt ggcgcgggcg gcggtggaat tccggtagtg       600
     cgtactgacg cgggagatta ccaaagcgtg gacgcggtta tcgacaaaga tccctctacc       660
     gcgctgctgg cccgtgaaat tcacgccgac attcttgtga tcaccactgg cgtcgaaaaa       720
     gtgtgtattc actttggcaa accgcagcag caggcgctcg atcgggtgga tattgccacc       780
     atgacccgct atatgcagga agggcatttc ccgcccggca gcatgttgcc aaaaatcatc       840
     gccagcctga catttttaga acaaggcggc aaagaagtga ttatcaccac gccggaatgc       900
     ctgcctgcgg cgctgcgcgg cgaaacgggc actcatatta ttaaaacgta a                951
//

If you have problems or comments...

PBIL Back to PBIL home page