(data stored in ACNUC7421 zone)

EMBL: CP001509.YAHJ

CP001509.YAHJ        Location/Qualifiers
FT   CDS_pept        310753..312135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahJ"
FT                   /locus_tag="ECD_00279"
FT                   /product="putative metallo-dependent hydrolase domain
FT                   deaminase"
FT                   /note="similar to b0324"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00279"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42178"
FT                   /protein_id="ACT42178.1"
FT                   /translation="MKESNSRREFLSQSGKMVTAAALFGTSVPLAHAAVAGTLNCEANN
FT                   TMKITDPHYYLDNVLLETGFDYENGVAVQTRTARQTVEIQDGKIVALRENKLHPDATLP
FT                   HYDAGGKLMLPTTRDMHIHLDKTFYGGPWRSLNRPAGTTIQDMIKLEQKMLPELQPYTQ
FT                   ERAEKLIDLLQSKGTTIARSHCNIEPVSGLKNLQNLQAVLARRQAGFECEIVAFPQHGL
FT                   LLSKSEPLMREAMQAGAHYVGGLDPTSVDGAMEKSLDTMFQIALDYDKGVDIHLHETTP
FT                   AGVAAINYMVETVEKTPQLKGKLTISHAFALATLNEQQVDELANRMVVQQISIASTVPI
FT                   GTLHMPLKQLHDKGVKVMTGTDSVIDHWSPYGLGDMLEKANLYAQLYIRPNEQNLSRSL
FT                   FLATGDVLPLNEKGERVWPKAQDDASFVLVDASCSAEAVARISPRTATFHKGQLVWGSV
FT                   AG"
     atgaaagaaa gcaatagccg ccgtgaattt ctgagccaga gcggtaagat ggtcaccgcc        60
     gccgcgctgt ttggtacctc tgtgccgctc gcccatgcgg cggtagctgg caccctaaac       120
     tgcgaagcga acaacaccat gaaaatcact gacccgcatt actatctcga taacgtgctg       180
     ctggaaaccg gttttgacta cgaaaatggc gtggcggtgc agacccgcac ggcgcgccag       240
     accgtggaga ttcaggacgg caaaattgtc gccctgcgcg agaacaagct gcatccggac       300
     gccacgctgc cgcactatga cgctggcggt aagctgatgc tgcccaccac ccgcgacatg       360
     catattcatc tcgacaaaac cttttacggc gggccgtggc gctcgctcaa tcgtccggca       420
     ggcaccacca tccaggacat gatcaaactc gagcagaaaa tgctgccgga actgcaaccg       480
     tacactcagg agcgggcaga aaaactgatt gatttattgc agtcgaaagg caccaccatt       540
     gcccgcagcc actgcaatat cgaaccggtt tccggcctga aaaatctgca aaatttgcag       600
     gcggtgctgg cgcgacgtca ggcgggcttt gagtgtgaaa tcgtcgcctt cccgcagcac       660
     ggtttgctgc tgtcgaaatc tgaaccttta atgcgtgaag cgatgcaggc gggggcgcat       720
     tacgtcggcg gcctggaccc gaccagtgtt gatggcgcga tggaaaaatc cctcgacacc       780
     atgttccaga ttgcgctgga ctacgacaaa ggcgtcgata ttcacctgca cgaaaccacg       840
     ccggcaggcg tggcagccat caattatatg gttgaaacgg tagagaaaac gccacagctg       900
     aagggcaagc tgaccatcag tcacgccttt gcgctggcaa cgctcaacga gcaacaggta       960
     gatgaactgg cgaaccggat ggtggtgcaa caaatttcta ttgcctcgac ggtgccgatt      1020
     ggcacgctgc atatgccgct caaacagttg cacgacaaag gcgtaaaagt gatgactggc      1080
     actgacagcg ttatcgacca ctggtcgcct tatggtctgg gcgacatgct ggaaaaagcc      1140
     aatctgtacg cgcagctcta tattcgtcct aacgaacaga acctctcccg ttcgctgttt      1200
     ctagccactg gcgatgtatt gccgctgaat gaaaaaggcg agcgtgtatg gccaaaagcg      1260
     caggatgacg ccagctttgt gctggtggac gcctcctgtt ctgccgaggc ggtggcgcgt      1320
     atctcgccga gaacagcaac gttccataaa gggcaactgg tgtgggggag tgtggcaggt      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page