(data stored in ACNUC7421 zone)

EMBL: CP001509.YAHL

CP001509.YAHL        Location/Qualifiers
FT   CDS_pept        313805..314620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahL"
FT                   /locus_tag="ECD_00281"
FT                   /product="uncharacterized protein"
FT                   /note="similar to b0326"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42180"
FT                   /protein_id="ACT42180.1"
FT                   /translation="MISLKAPHNNLMPYTQQSILNTVKNNQLPEDIKSSLVSCVDIFKV
FT                   LIKQYYDYPYDCRDDLVDDDKLIHLMAAVRDCEWSDDNALTINVQFNDFPGFYDWMDYP
FT                   DHPVKFVFHILENQKGTVWVYDQDDAFLDIKANVQAGRFTGLKKLVQFIDSVRTDCKCI
FT                   LLEYHMPLLRIFPKGKECMHVEKWLREMSSIPETDAPIKQALAHGLLLHLKNIYPVFPE
FT                   SLVMLLLSVLDVKTYRDDARLNEWISNRVQELGDRYYPVNKHVKIRYTL"
     atgatatcat taaaagctcc gcacaataat ttgatgccat atacgcaaca aagcatactt        60
     aatacggtta aaaacaatca gttaccagag gatatcaaaa gctccctggt ttcctgtgtc       120
     gatatattca aggttttgat taaacaatat tatgattatc cttatgattg tcgtgatgat       180
     ttagtcgatg acgacaaact cattcatctc atggctgccg tacgagactg tgagtggtca       240
     gacgataacg cactcaccat aaatgtgcag tttaatgatt tccctggatt ttatgactgg       300
     atggattacc ctgatcaccc ggttaagttt gtttttcaca tacttgaaaa tcaaaaaggg       360
     acagtttggg tatatgacca ggatgatgcg tttcttgata ttaaagcaaa cgtgcaggct       420
     ggacgcttta ccgggcttaa gaaattagtg cagtttatcg attcagtgcg aacagattgc       480
     aaatgtattc ttcttgaata ccatatgcct ttgctgagaa ttttccctaa agggaaagag       540
     tgtatgcatg tggaaaaatg gcttcgcgaa atgtcgtcta ttccggagac agacgcgccc       600
     attaagcagg cgcttgcgca tggattatta ttacacttaa aaaatatcta ccctgttttt       660
     cctgaatcac tggtgatgtt attgctctct gttctggacg taaaaacata cagagatgat       720
     gcgcgattaa atgaatggat atctaataga gtgcaggaat taggtgacag atattatcct       780
     gtaaataagc acgttaaaat ccgctacact ctttag                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page