(data stored in ACNUC7421 zone)

EMBL: CP001509.YAHN

CP001509.YAHN        Location/Qualifiers
FT   CDS_pept        complement(315295..315966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahN"
FT                   /locus_tag="ECD_00283"
FT                   /product="amino acid exporter for proline, lysine,
FT                   glutamate, homoserine"
FT                   /note="similar to b0328"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42182"
FT                   /protein_id="ACT42182.1"
FT                   /translation="MMKLLHLFMDEITMDPLHAVYLTVGLFVITFFNPGANLFVVVQTS
FT                   LASGRRAGVLTGLGVALGDAFYSGLGLFGLATLITQCEEIFSLIRIVGGAYLLWFAWCS
FT                   MRRQSTPQMSTLQQPISAPWYVFFRRGLITDLSNPQTVLFFISIFSVTLNAETPTWARL
FT                   MAWAGIVLASIIWRVFLSQAFSLPAVRRAYGRMQRVASRVIGAIIGVFALRLIYEGVTQ
FT                   R"
     atgatgaagt tacttcactt atttatggat gaaatcacta tggatccttt gcacgccgtt        60
     tacctgaccg taggactgtt cgtgattact ttttttaatc cgggagccaa tctctttgtg       120
     gtagtacaaa ccagcctggc ttccggtcga cgcgcagggg tgctgaccgg gctgggcgtg       180
     gcgctgggcg atgcatttta ttccgggttg ggtttgtttg gtcttgcaac gctaattacg       240
     cagtgtgagg agattttttc gcttatcaga atcgtcggcg gcgcttatct cttatggttt       300
     gcgtggtgca gcatgcgccg ccagtcaaca ccgcaaatga gcacactaca acaaccgatt       360
     agcgccccct ggtatgtctt ttttcgccgc ggattaatta ccgatctctc taacccgcaa       420
     accgttttat tttttatcag tattttctca gtaacattaa atgccgaaac accaacatgg       480
     gcacgtttaa tggcctgggc ggggattgtg ctcgcatcaa ttatctggcg agtttttctt       540
     agtcaggcgt tttctttgcc cgctgtgcgt cgtgcttatg ggcgtatgca acgcgttgcc       600
     agtcgggtta ttggtgcaat tattggtgta ttcgcgctac gcctgattta cgaaggggtg       660
     acgcagcggt ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page