(data stored in ACNUC7421 zone)

EMBL: CP001509.YAIL

CP001509.YAIL        Location/Qualifiers
FT   CDS_pept        346107..346646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="ECD_00308"
FT                   /product="DUF2058 family protein"
FT                   /note="similar to b0354"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00308"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42207"
FT                   /protein_id="ACT42207.1"
FT                   /translation="MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEEN
FT                   KKAQLERDKQLSEQQKQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFV
FT                   DKLTQAQLINGRLAIARLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQD
FT                   EDDPYADFKVPDDLMW"
     atggcaaaac ttaccttaca agagcagttg ctcaaagcag gattagtcac cagcaaaaaa        60
     gcggcgaagg tggagagaac ggcgaaaaaa tcgcgcgttc aggcgcgtga agctcgggcg       120
     gcggtagaag aaaataaaaa ggcacagctt gagcgtgata aacagcttag cgaacagcaa       180
     aaacaagcgg cgttggcgaa agaatataaa gctcaggtga agcagcttat tgaaatgaac       240
     cgaatcacca ttgccaatgg cgatattggt tttaacttca ctgacggcaa tctgattaag       300
     aagatttttg tcgataagct cacacaggcg cagttgatta atggtcgtct ggcgattgcc       360
     cgcttgttgg tcgataacaa tagcgaaggt gaatacgcca ttattcccgc cagcgttgcc       420
     gataaaattg ctcagcgcga tgccagcagt atagtgttgc acagcgcgct cagcgccgaa       480
     gagcaggatg aagacgaccc gtatgccgac ttcaaagtgc ctgatgattt gatgtggtaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page