(data stored in ACNUC7421 zone)

EMBL: CP001509.YAIT

CP001509.YAIT        Location/Qualifiers
FT   CDS_pept        356137..359043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiT"
FT                   /locus_tag="ECD_00321"
FT                   /product="hypothetical protein"
FT                   /note="similar to b0371-b0374"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42220"
FT                   /protein_id="ACT42220.1"
FT                   /translation="MHSWKKKLVVSQLALACTLAITSQANAANYDTWTYIDNPVTALDW
FT                   DHMDKAGTVDGNYVNYSGFVYYNNTNGDFDQSFNGDTVNGTISTYYLNHDYADSTANQL
FT                   DISNSVIHGSITSMLPGGYYDRFDADGNNLGGYDFYTDAVVDTHWRDGDVFTLNIANTT
FT                   IDDDYEALYFTDSYKDGDVTKHTNETFDTSEGVAVNLDVESNINISNNSRVAGIALSQG
FT                   NTYNETYTTESHTWDNNISVKDSTVTSGSNYILDSNTYGKTGHFGNSDEPSDYAGPGDV
FT                   AMSFTASGSDYAMKNNVFLSNSTLMGDVAFTSTWNSNFDPNGHDSNGDGVKDTNGGWTD
FT                   DSLNVDELNLTLDNGSKWVGQAIYNVAETSAMYDVATNSLTPDATYENNDWKRVVDDKV
FT                   FQSGVFNVALNNGSEWDTTGRSIVDTLTVNNGSQVNVSESKLTSDTIDLTNGSSLNIGE
FT                   DGYVDTDHLTINSYSTVALTESTGWGADYNLYANTITVTNGGVLDVNVDQFDTEAFRTD
FT                   KLELTSGNIADHNGNVVSGVFDIHSSDYVLNADLVNDRTWDTSKSNYGYGIVAMNSDGH
FT                   LTINGNGDVDNGTELDNSSVDNVVAATGNYKVRIDNATGAGAIADYKDKEIIYVNDVNS
FT                   NATFSAANKADLGAYTYQAEQRGNTVVLQQMELTDYANMALSIPSANTNIWNLEQDTVG
FT                   TRLTNSRHGLADNGGAWVSYFGGNFNGDNGTINYDQDVNGIMVGVDTKIDGNNAKWIVG
FT                   AAAGFAKGDMNDRSGQVDQDSQTAYIYSSAHFANNVFVDGSLSYSHFNNDLSATMSNGT
FT                   YVDGSTNSDAWGFGLKAGYDFKLGDAGYVTPYGSVSGLFQSGDDYQLSNDMKVDGQSYD
FT                   SMRYELGVDAGYTFTYSEDQALTPYFKLAYVYDDSNNDNDVNGDSIDNGTEGSAVRVGL
FT                   GTQFSFTKNFSAYTDANYLGGGDVDQDWSANVGVKYTW"
     atgcactcct ggaaaaagaa acttgtagta tcacaattag cattggcttg cactctggct        60
     atcacctctc aggctaatgc agcaaactat gatacctgga cttatatcga taatcccgtt       120
     acagcacttg attgggatca tatggataag gcaggcactg tagatggcaa ctatgtaaac       180
     tatagtggtt ttgtctatta caacaacacc aatggtgatt tcgatcagtc ctttaacggc       240
     gataccgtta acggcacgat ctcaacctat tatttgaacc atgattatgc agacagtact       300
     gctaatcagc ttgatatcag taattcagtg attcacggtt cgattacttc tatgctgcct       360
     ggcggttatt atgatcgttt tgatgcagat ggtaataatc tgggtggata tgatttttac       420
     actgatgcgg ttgttgatac acactggcgt gatggtgatg ttttcacttt gaacattgct       480
     aacactacta ttgatgatga ttatgaagct ctttacttca ctgattctta taaagatggt       540
     gatgtaacca agcacacaaa tgagacattt gatacaagtg aaggcgttgc tgttaatctt       600
     gatgtagaaa gtaacatcaa tatttccaat aactcccgcg ttgcaggtat tgcattatct       660
     caaggtaata cttacaacga aacctacact accgaatctc atacttggga taacaatatc       720
     tctgtaaaag attccacagt gacttcgggt tcaaattata tcctggatag caatacttat       780
     ggcaaaactg gtcactttgg caattctgat gaaccgagtg attatgctgg cccgggtgat       840
     gttgcaatgt cctttactgc ttcaggttcc gactatgcga tgaagaacaa tgtattcctc       900
     agcaattcaa cgctgatggg tgatgttgcc tttaccagca cctggaatag taattttgat       960
     ccgaatggtc atgattccaa cggtgacggg gtgaaagata ccaacggggg ttggactgat      1020
     gatagcctca acgttgatga actaaatctc actctcgata acggaagcaa gtgggttggt      1080
     caggcaattt ataacgttgc tgaaacgtca gcaatgtatg atgttgctac aaacagcctt      1140
     actcctgatg caacatatga aaacaatgac tggaaacgtg ttgttgatga caaggtcttc      1200
     cagagcggtg tatttaacgt agcgttgaat aacggttctg aatgggatac tacaggtcgt      1260
     tccatcgttg ataccttgac agttaataat ggttctcagg ttaatgtttc ggaatctaaa      1320
     ttaacttcag atactatcga tttaactaac ggttcttcgc tgaacattgg tgaagatggc      1380
     tacgttgata ccgatcatct gactattaac tcctacagta ctgttgcgtt gaccgaatct      1440
     actgggtggg gggctgatta caacctgtac gccaatacta tcaccgtaac taacggcggt      1500
     gtattggatg tgaacgttga tcagttcgat actgaagctt tccgtactga caaactggaa      1560
     ctgaccagcg gcaacatcgc tgaccataac ggtaacgtag tatctggtgt gttcgatatc      1620
     catagcagcg attacgttct gaacgctgat ctggtgaacg accgtacctg ggatacttcc      1680
     aagtctaact acggttacgg tattgttgct atgaactctg atggtcacct gactatcaac      1740
     ggtaacggcg acgtagacaa cggtactgaa ctggataaca gctctgtaga caatgttgtt      1800
     gctgcaaccg gtaactacaa agttcgtatc gacaacgcaa ctggcgctgg cgctatcgct      1860
     gattacaaag ataaagaaat tatctacgta aacgacgtca acagcaacgc gaccttctct      1920
     gctgctaaca aagctgacct gggtgcatac acctatcagg ctgaacagcg cggtaacacc      1980
     gttgttctgc aacagatgga gctgaccgac tacgctaaca tggcgctgag catcccgtct      2040
     gcgaacacca atatctggaa cctggaacaa gacaccgttg gtactcgtct gaccaactct      2100
     cgtcatggcc tggctgataa cggcggcgca tgggtaagct acttcggtgg taacttcaac      2160
     ggcgacaacg gcaccatcaa ctatgatcag gatgttaacg gcatcatggt cggtgttgat      2220
     accaaaattg acggtaacaa cgctaagtgg atcgtcggtg cggctgcagg cttcgctaaa      2280
     ggtgacatga atgaccgttc tggtcaggtg gatcaagaca gccagactgc ctacatctac      2340
     tcttctgctc acttcgcgaa caacgtcttt gttgatggta gcttgagcta ctctcacttc      2400
     aacaacgacc tgtctgcaac catgagcaac ggtacttacg ttgacggtag caccaactcc      2460
     gacgcttggg gcttcggttt gaaagccggt tacgacttca aactgggtga tgctggttac      2520
     gtgactcctt acggcagcgt ttctggtctg ttccagtctg gtgatgacta ccagctgagc      2580
     aacgacatga aagttgacgg tcagtcttac gacagcatgc gttatgaact gggtgtagat      2640
     gcaggttata ccttcaccta cagcgaagat caggctctga ctccgtactt caaactggct      2700
     tacgtctacg acgactctaa caacgataac gatgtgaacg gcgattccat cgataacggt      2760
     actgaagggt ctgcggtacg tgttggtctg ggtactcagt tcagcttcac caagaacttc      2820
     agcgcctata ccgatgctaa ctacctcggt ggtggtgacg tagatcaaga ctggtccgcg      2880
     aacgtgggtg ttaaatatac ctggtaa                                          2907
//

If you have problems or comments...

PBIL Back to PBIL home page