(data stored in ACNUC7421 zone)

EMBL: CP001509.YAIW

CP001509.YAIW        Location/Qualifiers
FT   CDS_pept        362497..363591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiW"
FT                   /locus_tag="ECD_00325"
FT                   /product="microcin Bac7 uptake protein; outer membrane
FT                   surface-exposed lipoprotein"
FT                   /note="similar to b0378"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42224"
FT                   /protein_id="ACT42224.1"
FT                   /translation="MSRVNPLSSLSLLAALVLAGCSSQAPQPLKKGEKAIDVASVVRQK
FT                   MPASVKDRDAWAKDLATTFESQGLAPTLENVCSVLAVAQQESNYQADPAVPGLSKIAWQ
FT                   EIDRRAERMHIPAFLVHTALKIKSPNGKSYSERLDSVRTEKQLSAIFDDLISMVPMGQT
FT                   LFGSLNPVRTGGPMQVSIAFAEQHTKGYPWKMDGTVRQEVFSRRGGLWFGTYHLLNYPA
FT                   SYSAPIYRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYDSKEPGKTELATRK
FT                   LAGKLGMSDSEIRRQLEKGDSFSFEETALYKKVYQLAEAKTGKSLPREMLPGIQLESPK
FT                   ITRNLTTAWFAKRVDERRARCMKQ"
     atgtcgcgcg tcaatcctct atcttcgctg tcattgttgg cggctctggt tttagcgggg        60
     tgtagtagtc aggctccgca accgttgaaa aagggcgaaa aagcgataga tgtagcgagc       120
     gtcgtgcggc agaagatgcc tgcgagcgtg aaagaccgcg atgcctgggc gaaagatctc       180
     gccaccacct ttgaaagtca ggggctggca ccgacgctgg aaaacgtctg ctcggtgctg       240
     gcggtggcgc agcaggagtc aaattatcag gcagatccgg ccgttccggg cttaagcaag       300
     atcgcctggc aagagattga ccgtcgtgct gaacggatgc acattcctgc ttttctggtt       360
     cataccgcgc taaaaatcaa atcgccaaac ggcaaaagtt atagcgaacg gttagattcg       420
     gtgcgtacag aaaagcaatt gagcgcgatt tttgacgatc tgatcagcat ggtaccaatg       480
     gggcagacgc tgtttggttc gcttaatccg gtgcgcaccg gtgggccgat gcaggtcagc       540
     attgcttttg ccgaacagca taccaaaggg tatccgtgga aaatggacgg tacagttcgt       600
     caggaagtct tcagtcgccg cggcgggttg tggtttggta cttaccattt actgaattat       660
     cccgccagct atagcgcacc gatataccgc tttgctgatt ttaacgctgg ctggtacgcc       720
     agccgtaatg ccgcgtttca gaacgcagtc agtaaggcca gcggcgtgaa gctggcactg       780
     gacggtgatt taattcgtta cgacagtaaa gaacccggga aaaccgaact ggcaacgcgc       840
     aaactggcgg gaaaactggg gatgagcgac agcgaaattc gccgtcagtt agagaaaggt       900
     gacagcttct cttttgagga gacggcgctg tacaagaaag tttatcaact tgccgaagcg       960
     aaaacgggta aatcactacc ccgcgaaatg ttgcctggca ttcaactgga aagcccgaaa      1020
     atcacccgca acctgactac ggcctggttt gcgaagcgcg tagacgaacg gcgggcgcgt      1080
     tgtatgaaac agtga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page