(data stored in ACNUC7421 zone)

EMBL: CP001509.YAJD

CP001509.YAJD        Location/Qualifiers
FT   CDS_pept        396006..396353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="ECD_00358"
FT                   /product="HNH nuclease family protein"
FT                   /note="similar to b0410"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42257"
FT                   /protein_id="ACT42257.1"
FT                   /translation="MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPF
FT                   ADLKAMMNKKK"
     atggctatca tcccaaaaaa ctatgcgcgg ttagaaagcg gctatcgcga aaaagcatta        60
     aaaatctatc cgtgggtctg cggtcgctgt tcccgcgagt ttgtttattc caacctgcgt       120
     gaacttaccg ttcaccacat tgatcacgac cataccaata acccggaaga tggcagtaac       180
     tgggaattgt tgtgtctcta ttgccacgat catgagcatt cgaaatatac cgaagcggat       240
     cagtatggta cgaccgttat cgcaggggaa gatgcgcaga aagatgtcgg tgaagcgaag       300
     tacaacccat tcgctgacct gaaagcgatg atgaacaaga agaagtga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page