(data stored in ACNUC7421 zone)

EMBL: CP001509.YAJQ

CP001509.YAJQ        Location/Qualifiers
FT   CDS_pept        410084..410575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="ECD_00374"
FT                   /product="phage Phi6 host factor, ATP/GTP binding protein"
FT                   /note="similar to b0426"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00374"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42273"
FT                   /protein_id="ACT42273.1"
FT                   /translation="MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDAS
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIES
FT                   ATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFRD
FT                   "
     atgccatctt tcgatattgt ctctgaagtt gatcttcagg aagcacgtaa cgcggtcgat        60
     aacgcgagtc gcgaagtgga gtcccgtttt gacttccgta acgttgaagc ctcatttgag       120
     ctgaacgacg ccagcaaaac catcaaagtg ttgagcgagt ccgacttcca ggtcaatcag       180
     ttgctggata ttctgcgtgc caagctgctg aagcgcggca ttgaaggcag ttcactggat       240
     gtaccggaaa atatcgttca tagcggtaaa acctggtttg tggaagcgaa actgaaacag       300
     ggcattgaga gcgcgaccca gaagaaaatc gtcaagatga ttaaagacag caaactgaaa       360
     gtgcaggcgc aaattcaggg cgatgagatc cgtgtgactg gcaaatctcg tgatgatttg       420
     caggctgtca tggcgatggt acgtggtggc gatctcggcc agccgttcca gttcaaaaac       480
     ttccgcgatt aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page