(data stored in ACNUC7421 zone)

EMBL: CP001509.YBAA

CP001509.YBAA        Location/Qualifiers
FT   CDS_pept        445718..446071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaA"
FT                   /locus_tag="ECD_00407"
FT                   /product="DUF1428 family protein"
FT                   /note="similar to b0456"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00407"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42306"
FT                   /protein_id="ACT42306.1"
FT                   /translation="MKYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASD
FT                   VPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAANQKMMSDPRMKEFGESMPFDGK
FT                   RMIYGGFESIIDE"
     atgaagtatg ttgatggttt tgtggttgcc gttcctgccg ataaaaagga tgcctatcgg        60
     gaaatggccg ctaaggctgc gccattgttt aaagagtttg gcgcgcttcg tattgtcgaa       120
     tgctgggcca gcgatgtacc ggatggcaaa gtgaccgatt ttcgtatggc ggtgaaagcg       180
     gaagagaatg aagaggttgt ctttagctgg attgaatacc cttcaaaaga ggtccgcgac       240
     gctgctaatc aaaagatgat gtcggaccca cggatgaaag agttcggcga gtccatgccg       300
     tttgacggca agcgaatgat ctatggcgga ttcgagtcaa tcatcgacga atag             354
//

If you have problems or comments...

PBIL Back to PBIL home page