(data stored in ACNUC7421 zone)

EMBL: CP001509.YBAB

CP001509.YBAB        Location/Qualifiers
FT   CDS_pept        463122..463451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="ECD_00422"
FT                   /product="DNA-binding protein, putative nucleoid-associated
FT                   protein"
FT                   /note="similar to b0471"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00422"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42321"
FT                   /protein_id="ACT42321.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
     atgtttggta aaggcggtct gggtaacctg atgaagcaag cccagcagat gcaagaaaaa        60
     atgcagaaaa tgcaggaaga gatcgcgcag ctggaagtca ccggcgaatc tggcgcaggt       120
     ctggtaaaag tgaccatcaa cggtgcacac aactgccgtc gcgtagagat cgacccgagc       180
     ctgctggaag acgacaaaga gatgctggaa gacctggtgg ctgcagcatt caacgacgca       240
     gcacgtcgta ttgaagaaac gcagaaagaa aaaatggcct ctgtatcctc cggaatgcag       300
     ctgccgcctg gctttaagat gccgttctga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page