(data stored in ACNUC7421 zone)

EMBL: CP001509.YBAT

CP001509.YBAT        Location/Qualifiers
FT   CDS_pept        481723..483015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaT"
FT                   /locus_tag="ECD_00437"
FT                   /product="putative amino acid transporter"
FT                   /note="similar to b0486"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00437"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42336"
FT                   /protein_id="ACT42336.1"
FT                   /translation="MMNTEGNNGNKPLGLWNVVSIGIGAMVGAGIFALLGQAALLMEAS
FT                   TWVAFAFGGIVAMFSGYAYARLGASYPSNGGIIDFFRRGLGNGVFSLALSLLYLLTLAV
FT                   SIAMVARAFGAYAVQFLHEGSQEEHLILLYALGIIAVMTLFNSLSNHAVGRLEVILVGI
FT                   KMMILLLLIIAGVWSLQPAHISVSAPPSSGAFFSCIGITFLAYAGFGMMANAADKVKDP
FT                   QVIMPRAFLVAIGVTTLLYISLALVLLSDVSALELEKYADTAVAQAASPLLGHVGYVIV
FT                   VIGALLATASAINANLFAVFNIMDNMGSERELPKLMNKSLWRQSTWGNIIVVVLIMLMT
FT                   AALNLGSLASVASATFLICYLAVFVVAIRLRHDIHASLPILIVGTLVMLLVIVGFIYSL
FT                   WSQGSRALIWIIGAILLSLIVAMVMKRNKTV"
     atgatgaaca cggaaggtaa taacggtaac aaacctctcg gtctatggaa cgtcgtttcc        60
     atcggcattg gggcaatggt gggggcgggg atcttcgcgc tgctggggca ggctgcattg       120
     ctaatggaag cctcgacctg ggtcgccttt gcttttggcg gtattgtggc gatgttttcc       180
     ggttatgcct atgcgcgtct gggggcgagc tatcccagca atggcggcat tatcgacttc       240
     tttcgtcgcg gattaggcaa cggcgtcttt tcgctggcgc tctcgttact gtacctgttg       300
     acgctggcgg tgagcatcgc catggtcgcc cgtgcttttg gcgcttatgc cgtgcagttt       360
     ttgcatgaag gcagccagga ggagcacctt attttgctct acgcgttggg gatcattgcg       420
     gtgatgacgc ttttcaactc cttaagcaac catgcggtag ggcggctgga agtgatcctc       480
     gtcggcatta aaatgatgat cctgttattg ctgattattg ccggtgtctg gtcgctgcaa       540
     ccggcgcata tttccgtctc tgcgcccccc agctccggtg cgttcttctc ctgtatcggg       600
     ataaccttcc ttgcctatgc gggctttggc atgatggcga acgcggcgga taaagtgaaa       660
     gatccgcagg tcattatgcc acgggcgttt ctggtggcga ttggcgttac cacgttgctt       720
     tatatctcgc tggcgctggt tttgcttagc gatgtatcgg cattagagtt agaaaaatat       780
     gccgataccg ccgtagcgca ggcagcttct ccgctgctcg ggcatgtggg ttatgtgatc       840
     gtcgtcatcg gcgctttact ggcgacggct tcagccatca acgcgaacct gttcgccgtg       900
     tttaacatca tggacaacat gggcagcgaa cgcgaactgc cgaagctaat gaataaatcc       960
     ctgtggcggc agagtacctg gggcaacatc atcgtcgtgg tgttgattat gctgatgacg      1020
     gcggcgctaa atttaggctc actcgccagc gttgccagcg ccaccttttt gatctgctat      1080
     ctggcggtgt ttgtggtggc gatccgcctg cgtcatgata ttcacgcctc gttgccgatt      1140
     cttatcgttg gtacgttggt gatgttgttg gtgatcgttg gctttatcta cagcctgtgg      1200
     tcccagggca gtcgtgcgtt gatatggatt attggtgcaa tcttactcag ccttattgtg      1260
     gcaatggtca tgaagcgcaa taaaaccgta taa                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page