(data stored in ACNUC7421 zone)

EMBL: CP001509.YBBC

CP001509.YBBC        Location/Qualifiers
FT   CDS_pept        496727..497095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbC"
FT                   /locus_tag="ECD_00449"
FT                   /product="putative immunity protein"
FT                   /note="similar to b0498"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00449"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42348"
FT                   /protein_id="ACT42348.1"
FT                   /translation="MKYSSIFSMLSFFILFACNETAVYGSDENIIFMRYVEKLHLDKYS
FT                   VKNTVKTETMAIQLAEIYVRYRYGERIAEEEKPYLITELPDSWVVEGAKLPYEVAGGVF
FT                   IIEINKKNGCVLNFLHSK"
     atgaaatata gttcaatatt ttcgatgctt tcatttttta tactatttgc ctgtaatgag        60
     acagctgttt acggttctga tgaaaacatt atttttatga ggtatgtgga aaaattacat       120
     ttagataaat actctgttaa aaatacggta aaaactgaaa caatggcgat acaattagct       180
     gaaatatatg ttaggtatcg ctatggcgaa cggattgcag aagaagaaaa accatattta       240
     attacggaac taccagatag ttgggttgtt gagggagcaa agttacctta tgaagttgcg       300
     ggtggtgtat ttattataga aattaataag aaaaatggat gtgttttgaa tttcctacat       360
     agtaaataa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page