(data stored in ACNUC7421 zone)

EMBL: CP001509.YBBD

CP001509.YBBD        Location/Qualifiers
FT   CDS_pept        497786..498046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbD"
FT                   /locus_tag="ECD_00451"
FT                   /product="hypothetical protein"
FT                   /note="similar to b0500"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42350"
FT                   /protein_id="ACT42350.1"
FT                   /translation="MLAISSNLSKMIIFIFAIIIIVVLCVITYLYLYKDESLVSKHYIN
FT                   YMAIPENDGVFTWLPDFFPHVAVDISIYTNVEDDYFFLIFP"
     atgctggcta tctcaagtaa tctatcaaag atgataatat ttatttttgc tattataatc        60
     attgttgttt tatgcgtaat tacttatctt tatttataca aagatgaatc tcttgtaagt       120
     aaacattaca taaactatat ggcaatacca gaaaatgatg gagtttttac atggctccca       180
     gatttttttc cgcacgtagc ggtggatata tcaatataca caaatgtaga agatgattat       240
     ttttttctta tttttcccta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page