(data stored in ACNUC7421 zone)

EMBL: CP001509.YBBJ

CP001509.YBBJ        Location/Qualifiers
FT   CDS_pept        complement(483548..484006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="ECD_00439"
FT                   /product="inner membrane protein; stimulator of the QmcA
FT                   suppressor of ftsH-htpX"
FT                   /note="similar to b0488"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42338"
FT                   /protein_id="ACT42338.2"
FT                   /translation="MMELIVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLV
FT                   VWLLPLGWEWQGVMFAILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLE
FT                   SPLVNGRGHMRVGDSSWPVSASEDLGAGTHVEVIAIEGITLHIRAVSS"
     atgatggagt taatagtcgt tcatccacat attttctggc tcagtctcgg cggtttgctg        60
     ctggcagccg agatgctggg cggaaatggt tatttgttgt ggagcggcgt ggcagcggtg       120
     attaccggcc tggtggtctg gctgttgccg ctgggttggg agtggcaagg ggtgatgttt       180
     gccatcctga cgctgctcgc cgcctggctg tggtggaaat ggttgtcgcg gcgggtgcgc       240
     gaacaaaagc acagcgatag tcatttaaac cagcgcgggc agcagctgat tggccgacgt       300
     tttgtgctgg aatctccgct ggtcaacggg cgcggtcata tgcgcgtcgg tgacagttca       360
     tggcctgtca gcgccagcga ggatctcggt gcaggtacgc atgttgaagt cattgcgata       420
     gaagggataa ccctacatat ccgagccgtc tcgtcttaa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page