(data stored in ACNUC7421 zone)

EMBL: CP001509.YBBN

CP001509.YBBN        Location/Qualifiers
FT   CDS_pept        complement(486572..487426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbN"
FT                   /locus_tag="ECD_00443"
FT                   /product="DnaK co-chaperone, thioredoxin-like protein"
FT                   /note="similar to b0492"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00443"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42342"
FT                   /protein_id="ACT42342.1"
FT                   /translation="MSVENIVNINESNLQQVLEQSMTTPVLFYFWSERSQHCLQLTPIL
FT                   ESLAAQYNGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRA
FT                   LLDKVLPREEELKAQQAMQLMQESNYTDALPLLKDAWQLSNQNGEIGLLLAETLIALNR
FT                   SEDAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVAENPEDAALATQL
FT                   ALQLHQVGRNEEALELLFGHLRKDLTAADGQTRKTFQEILAALGTGDALASKYRRQLYA
FT                   LLY"
     atgtccgtag aaaatattgt caacattaac gaatctaacc tgcaacaggt tcttgaacag        60
     tcgatgacca ctccggtgct gttctatttt tggtctgaac gtagccagca ctgtttgcag       120
     ttaaccccga tcctggaaag cctcgcggcg cagtacaacg ggcaatttat tctggcgaag       180
     ctggactgcg acgcggagca gatgattgcc gcccagtttg gtctgcgcgc gattccgacc       240
     gtgtatctgt tccagaacgg gcaaccggta gatggcttcc aggggccgca accggaagag       300
     gcgatccgcg ccctgctgga taaagtgctg ccgcgcgaag aagagctgaa agcgcagcag       360
     gcgatgcaac tgatgcagga aagcaattac accgatgccc tgccattgct gaaagacgcc       420
     tggcagttgt cgaatcagaa cggggagatc ggcctgctgc tggcagaaac gctgattgcg       480
     ctgaaccgtt ctgaagatgc ggaagcggtg ctgaaaacca ttccgttgca ggatcaggac       540
     acccgctacc aggggctggt ggcgcaaatc gaactgctga agcaggcggc tgatactccg       600
     gaaattcaac agttgcaaca gcaggtggcg gagaatccag aagatgccgc actggcgacg       660
     caactggcgc tgcaactgca tcaggttggg cgcaatgaag aggcgctgga gttgctgttc       720
     gggcatctgc gtaaagatct caccgccgca gacggtcaga cgcgtaaaac gttccaggag       780
     atcctcgctg cgctgggtac gggtgatgca ctggcgtcga agtatcgccg ccagctgtat       840
     gcattgttgt attga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page