(data stored in ACNUC7421 zone)

EMBL: CP001509.YBBV

CP001509.YBBV        Location/Qualifiers
FT   CDS_pept        506641..506919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbV"
FT                   /locus_tag="ECD_00460"
FT                   /product="hypothetical protein"
FT                   /note="similar to b0510"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42359"
FT                   /protein_id="ACT42359.1"
FT                   /translation="MNRPEILKKKAAKDVASVLKIIFLFYLFLMARLKQRYSIREIKRD
FT                   LWNIRENYSSNAAIAKIYCRKRKASGPGKHLTILPYGWVRFITFPIM"
     atgaatcggc cagaaatatt aaaaaagaaa gcagccaaag atgttgcttc agtattaaaa        60
     ataatatttt tattttattt gttcctcatg gctagattaa aacaacgtta ttcgatacgt       120
     gaaattaaga gggatttatg gaacatcaga gaaaactatt ccagcaacgc ggctatagcg       180
     aagatctatt gccgaaaacg caaagccagc ggacctggaa aacatttaac tattttacct       240
     tatggatggg ttcggttcat aacgttccca attatgtga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page