(data stored in ACNUC7421 zone)

EMBL: CP001509.YBCF

CP001509.YBCF        Location/Qualifiers
FT   CDS_pept        519584..520477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /locus_tag="ECD_00471"
FT                   /product="putative carbonate kinase"
FT                   /note="similar to b0521"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42370"
FT                   /protein_id="ACT42370.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKEVEPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTV
FT                   LTRIEVSPDDPAFLQPEKFIGPVYQPEEQEALEAAYGWQMKRDGKYLRRVVASPQPRKI
FT                   LDSEAIELLLKEGHVVICSGGGGVPVTEDGAGSEAVIDKDLAAALLAEQINADGLVILT
FT                   DADAVYENWGTPQQRAIRHATPDELAPFAKADGSMGPKVTAVSGYVRSRGKPAWIGALS
FT                   RIEETLAGEAGTCISL"
     atgaaaacac tggttgtagc tcttgggggc aacgccttac tccagcgcgg tgaggcgctg        60
     acggcggaaa atcaatatcg caatatcgcc agtgctgtac ccgcgctggc acgcctggcc       120
     cgttcttatc ggctggcgat tgttcacggc aacgggccgc aggtggggct gctggcgtta       180
     cagaatctgg cgtggaaaga ggtagaaccg tatccgctgg atgtgctggt ggcggaaagc       240
     caggggatga ttggctatat gctggcgcag agcttgagcg cacagccgca gatgccgcct       300
     gttacgacgg tgctgacgcg cattgaggtt tcgcctgatg atccggcgtt tttgcagcca       360
     gagaaattta ttggtccggt ttatcagcca gaagaacaag aggcactgga agcggcttac       420
     ggctggcaga tgaaacgtga tggtaaatat ttgcgccggg tggtggcgtc tccgcaaccg       480
     cgtaaaattc tcgacagcga agccatcgag ttgttgctca aagaggggca tgtggtgatt       540
     tgcagtggcg gcggcggtgt gcctgtgacg gaagacgggg cagggagtga agcggtgatt       600
     gataaagatc tcgccgctgc cttgcttgcc gagcagatta acgccgatgg gctggtgatc       660
     ctcaccgatg ctgatgcggt atatgaaaac tggggaacgc cgcagcaacg cgccattcgc       720
     catgccacac cggatgagtt agcgccattt gccaaagccg atggttcgat ggggccgaag       780
     gtaacggcgg tgagtggtta tgtcagaagc cgtggtaaac ccgcgtggat tggggcgtta       840
     tcgcgaattg aagagacgct ggcgggcgaa gcggggacct gtatttcgct gtag             894
//

If you have problems or comments...

PBIL Back to PBIL home page