(data stored in ACNUC7421 zone)

EMBL: CP001509.YBCI

CP001509.YBCI        Location/Qualifiers
FT   CDS_pept        complement(525119..525640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="ECD_00477"
FT                   /product="DUF457 family inner membrane protein"
FT                   /note="similar to b0527"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00477"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42376"
FT                   /protein_id="ACT42376.1"
FT                   /translation="MPTVITHAAVPLCIGLGLGSKVIPPRLLFAGIILAMLPDADVLSF
FT                   NFGVAYGNVFGHRGFTHSLVFAFVVPLLCVLIGRRWFRAGLIRCWLFLTVSLLSHSLLN
FT                   SVTTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSRYTTAYGHQVIISELMWVWLPGML
FT                   LMGMLWWRRR"
     atgccaaccg ttattacgca cgccgccgtt cccctatgca ttggtttagg gttgggttcg        60
     aaagtcatcc ctccgcgcct gttatttgcc ggaatcatcc tggcgatgct gcccgatgcc       120
     gacgtcttgt cgtttaattt tggcgttgct tacggcaatg tttttggtca tcgcgggttt       180
     acccattcgc tggtgtttgc gtttgttgtc ccgctgttat gtgtgctgat tggacgtcga       240
     tggttcaggg ctgggctgat tcgctgctgg ctgtttttaa ccgtctcgtt gctatcgcac       300
     agcttgctga attcggtaac cactggcggt aaaggggttg gctggctgtg gccgtggtca       360
     gatgaacgct ttttcgctcc ctggcaggtg attaaagtcg cgccgtttgc attgtctcgt       420
     tacaccacag cgtacgggca tcaggtgatt atttctgaat tgatgtgggt gtggttgccg       480
     gggatgctac tgatgggaat gttgtggtgg cgcagacgat aa                          522
//

If you have problems or comments...

PBIL Back to PBIL home page