(data stored in ACNUC7421 zone)

EMBL: CP001509.YBCN

CP001509.YBCN        Location/Qualifiers
FT   CDS_pept        541061..541516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcN"
FT                   /locus_tag="ECD_00497"
FT                   /product="DLP12 prophage; uncharacterized protein"
FT                   /note="similar to b0547"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42395"
FT                   /protein_id="ACT42395.1"
FT                   /translation="MNLSQDGIKLHRGNFTAIGRQIQPYLEEGKCFRMVLKPWREKRSL
FT                   SQNALSHMWYSEISEYLISRGKTFATPAWVKDALKHTYLGYETKDLVDVVTGDITTIQS
FT                   LRHTSDLDTGEMYVFLCKVEAWAMNIGCHLTIPQSCEFQLLRDKQEA"
     gtgaacctct cacaagacgg catcaaatta catcgcggca acttcaccgc tatcggtcgg        60
     cagatccagc cttatctgga ggagggcaaa tgctttcgca tggtgcttaa accgtggcgt       120
     gagaaacgca gtctttccca gaatgcactc agccacatgt ggtacagcga aatcagtgaa       180
     tacctcatca gcaggggtaa aacgttcgcc actccagctt gggtaaaaga tgctctcaaa       240
     cacacatatc tcggttatga aaccaaagac ctggttgatg tcgtaaccgg tgatatcacc       300
     actatccagt cgttacgcca tacctccgac cttgataccg gagagatgta tgtcttcctg       360
     tgtaaggttg aagcctgggc gatgaatatt ggctgccacc tgactattcc gcagagctgc       420
     gagttccagc tgctgcgtga taagcaggag gcgtaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page