(data stored in ACNUC7421 zone)

EMBL: CP001509.YBDF

CP001509.YBDF        Location/Qualifiers
FT   CDS_pept        complement(564187..564555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdF"
FT                   /locus_tag="ECD_00540"
FT                   /product="DUF419 family protein"
FT                   /note="similar to b0579"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42420"
FT                   /protein_id="ACT42420.1"
FT                   /translation="MDKQSLHETAKRLALELPFVELCWPFGPEFDVFKIGGKIFMLSSE
FT                   LRGVPFINLKSDPQKSLLNQQIYPSIKPGYHMNKKHWISVYPGEEISEALLRDLINDSW
FT                   NLVVDGLAKRDQKRVRPG"
     atggataagc aatcactgca cgaaacggcg aaacgcctgg cccttgagtt accctttgtc        60
     gagctttgct ggccttttgg cccggagttc gatgttttta aaattggcgg caagattttt       120
     atgctgtcgt cggagctacg cggcgtcccc tttatcaatc tgaagtccga tccacaaaaa       180
     tccctgttaa atcagcaaat atacccaagc attaagccag ggtatcacat gaataaaaag       240
     cactggattt cggtgtatcc cggcgaggaa atctccgaag cgttacttcg cgatctgatc       300
     aacgattcgt ggaatctggt ggttgatggt ctggctaaac gcgatcaaaa aagagtgcgt       360
     ccaggctaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page