(data stored in ACNUC7421 zone)

EMBL: CP001509.YBDJ

CP001509.YBDJ        Location/Qualifiers
FT   CDS_pept        complement(564620..564868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdJ"
FT                   /locus_tag="ECD_00541"
FT                   /product="DUF1158 family putative inner membrane protein"
FT                   /note="similar to b0580"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42421"
FT                   /protein_id="ACT42421.1"
FT                   /translation="MKHPLETLTTAAGILLMAFLSCLLLPAPALGLTLAQKLVSTFHLM
FT                   DLSQLYTLLFCLWFLVLGAIEYFVLRFIWRRWFSLAD"
     atgaaacacc ctttagaaac cttgaccacc gcagcaggca ttttgctgat ggctttcctc        60
     tcttgcctgc tgcttcccgc ccccgcattg gggctgacgc tggcacaaaa actggtgagc       120
     acgttccatc tgatggatct tagtcagctt tacactttat tgttttgtct gtggttttta       180
     gtgctgggcg ctattgagta ttttgttctg cgctttatct ggcgacgctg gttctcgctg       240
     gcggattaa                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page