(data stored in ACNUC7421 zone)

EMBL: CP001509.YBDM

CP001509.YBDM        Location/Qualifiers
FT   CDS_pept        complement(595223..595852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="ECD_00569"
FT                   /product="Spo0J family protein, ParB-like nuclease domain"
FT                   /note="similar to b0601"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00569"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42447"
FT                   /protein_id="ACT42447.1"
FT                   /translation="MGDTMQQRLTQDLTQFLASLPEDDRIKAINEIRMAIHQVSPFREE
FT                   PVDCVLWVKNDQLVPNDYNPNNVAPPEKKLLKKSIEIDGFTQPIVVTHTDKNALEIVDG
FT                   FHRHEIGKGSSSLKLRLKGYLPVTCLEGTRNQRIAATIRHNRARGRHQITAMSEIVREL
FT                   SQLGWDDNKIGKELGMDSDEVLRLKQINGLQELFADRQYSRAWTVK"
     atgggggata ctatgcaaca acgattaacg caggatttaa cgcaatttct cgccagcttg        60
     ccggaagacg atcgcatcaa agcgattaat gaaatccgca tggcgatcca tcaggtaagt       120
     ccttttcggg aagaaccggt agattgtgtt ttgtgggtca aaaatgatca gcttgtgccg       180
     aatgattaca acccaaacaa cgtggcacca cccgaaaaaa aactgctgaa aaaatccatt       240
     gaaatagatg gttttaccca acccattgtg gtcacgcata cggataaaaa tgccctggaa       300
     atcgtggatg gttttcaccg ccatgaaatt ggtaaaggct catcatcgtt aaaattacgc       360
     ttaaaaggtt atttgccggt gacctgtctg gaaggtacgc gtaatcaacg catcgccgcg       420
     actattcgtc ataatcgcgc tcgtggacgc catcaaatca ccgccatgtc ggaaatcgtc       480
     cgtgaactta gccagttggg atgggacgat aataaaattg gcaaagagct gggaatggac       540
     agcgacgaag tgctgcgcct gaagcaaatt aacggcctgc aagagttgtt tgccgaccgt       600
     caatattccc gcgcctggac ggttaaataa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page