(data stored in ACNUC7421 zone)

EMBL: CP001509.YBDN

CP001509.YBDN        Location/Qualifiers
FT   CDS_pept        complement(595825..596886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdN"
FT                   /locus_tag="ECD_00570"
FT                   /product="PAPS reductase-like domain protein"
FT                   /note="similar to b0602"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42448"
FT                   /protein_id="ACT42448.1"
FT                   /translation="MGKKICVLFIDWEAQFSCTINYVQSLRELYTDVIEEFYWVALPLT
FT                   TQNSLSQYQPEWQCWEPDVEWVRQPPQDAITDPDFFSFYQPGMTFEQFVREFAEWFSQK
FT                   RPAAMMIGIRADESYNRFVAIASLNKQRFADDKPWTTAAPGGHSWYIYPIYDWKVADIW
FT                   TWYANHQSLCNPLYNLMYQAGVPLRHMRICEPFGPEQRQGLWLYHVIEPDRWAAMCARV
FT                   SGVKSGGIYAGHDNHFYGHRKILKPEHLDWQEYALLLLNSMPEKTAEHYRNKIAIYLHW
FT                   YQKKGIEVPQTQQGDIGAKDIPSWRRICKVLLNNDYWCRALSFSPTKSKNYQRYNERIK
FT                   GKRQEWGILCNND"
     atgggcaaaa aaatctgcgt tttgtttatc gactgggagg cgcaattctc ttgcaccatt        60
     aactatgttc agtccctgcg cgagttgtac accgatgtca tcgaagagtt ttactgggtt       120
     gcgctcccgc ttacgacgca aaattccctt tcacaatacc aacccgaatg gcagtgctgg       180
     gaacctgatg tcgaatgggt acgtcaacct ccccaagatg cgataaccga ccctgacttt       240
     ttctcctttt accagccagg catgaccttc gaacaatttg tacgtgagtt tgccgaatgg       300
     ttttcacaaa aacgtccggc ggcgatgatg atcggcatcc gtgcggatga gtcctacaac       360
     cgttttgtcg ccatcgccag tttaaataaa caacgttttg ccgacgataa accctggact       420
     acggccgcac caggcggtca tagctggtac atttacccca tttacgactg gaaagtggct       480
     gatatctgga cctggtatgc aaatcatcaa agtctctgca acccactgta taacctaatg       540
     tatcaggcag gcgttcctct gcgtcatatg cgaatttgcg aaccttttgg cccggagcaa       600
     cgacaaggat tatggctcta tcacgttatc gaaccggatc gctgggctgc tatgtgcgca       660
     cgagtcagcg gggtaaaaag tggcggcatt tacgccggac atgacaatca tttctatggg       720
     catcggaaaa tcctcaagcc agaacattta gactggcaag aatatgcatt attgctgctc       780
     aatagcatgc cggaaaaaac agctgagcat taccgcaata aaatcgccat ttatttgcac       840
     tggtatcaga aaaaaggcat cgaggttcca caaacccagc aaggggacat tggcgcgaaa       900
     gatatcccct cctggcggcg gatatgcaaa gttttactca ataacgatta ctggtgtcgg       960
     gcattatcat ttagccccac aaaatcgaag aactatcagc gttataacga acggataaaa      1020
     ggaaaacgtc aggaatgggg gatactatgc aacaacgatt aa                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page