(data stored in ACNUC7421 zone)

EMBL: CP001509.YBED

CP001509.YBED        Location/Qualifiers
FT   CDS_pept        complement(622741..623004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeD"
FT                   /locus_tag="ECD_00600"
FT                   /product="UPF0250 family protein"
FT                   /note="similar to b0631"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42478"
FT                   /protein_id="ACT42478.1"
FT                   /translation="MKTKLNELLEFPTPFTYKVMGQALPELVDQVVEVVQRHAPGDYTP
FT                   TVKPSSKGNYHSVSITINATHIEQVETLYEELGKIDIVRMVL"
     atgaaaacca aacttaacga actgcttgaa ttccctactc cttttactta caaagttatg        60
     gggcaggcgt tacctgagct ggttgatcag gtggttgaag tggtacagcg ccatgcgcca       120
     ggtgactaca ccccaacggt aaaaccaagc agcaaaggca actaccactc ggtatctatc       180
     actatcaacg ccactcatat cgagcaggtt gaaacactgt atgaagaact gggcaaaatc       240
     gatattgtcc gcatggttct gtaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page