(data stored in ACNUC7421 zone)

EMBL: CP001509.YBEM

CP001509.YBEM        Location/Qualifiers
FT   CDS_pept        618392..619180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeM"
FT                   /locus_tag="ECD_00595"
FT                   /product="putative NAD(P)-binding amidase-type enzyme YbeM
FT                   (C-N hydrolase family)"
FT                   /note="similar to b0625-b0626"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42473"
FT                   /protein_id="ACT42473.1"
FT                   /translation="MLVAAGQFAVTSVWEKNAEICASLMAQAAENDVSLFVLPEALLAR
FT                   DDHDADLSVKSAQLLEGEFLGRLRRESKRNMMTTILTIHVPSTPGRAWNMLVALQAGNI
FT                   VARYAKLHLYDAFAIQESRRVDAGNEIAPLLEVEGMKVGLMTCYDLRFPELALAQALQG
FT                   AEILVLPAAWVRGPLKEHHWSTLLAARALDTTCYMVAAGECGNKNIGQSRIIDPFGVTI
FT                   AAASEMPALIMAEVTPERVRQVRAQLPVLNNRRFAPPQLL"
     atgctggttg ccgcaggaca gtttgctgtt acatctgtgt gggaaaagaa cgctgagatt        60
     tgtgcctcgt tgatggcgca ggcggcggaa aacgacgtat cgctgttcgt cctgccggaa       120
     gcattgctgg cgcgcgatga tcatgatgca gatctatcgg ttaaatcagc acagctgctg       180
     gaaggcgaat tcctcggacg tttacggcga gaaagtaaac gtaacatgat gacgacaatt       240
     ctgacgattc atgttccttc aacgccgggg cgcgcatgga atatgctggt ggcgctacag       300
     gcaggaaaca tcgtcgcccg ttatgccaaa ttgcatctct atgatgcatt tgccattcag       360
     gaatcacgcc gtgttgatgc tggtaatgaa atcgctccgt tactggaggt ggaggggatg       420
     aaggtcggtc tgatgacctg ttatgactta cgctttccag agctggcgct ggcacaggca       480
     ttacagggag ctgaaatcct ggtacttcct gccgcctggg ttcgcgggcc gctcaaagag       540
     catcactggt caacgttgct tgccgctcgt gcgctggata ccacctgtta tatggtggcg       600
     gcgggggagt gcgggaacaa aaatatcggg caaagccgga ttatagatcc ctttggcgtc       660
     accattgcgg cagcgtcaga aatgcctgca ctcattatgg cggaagtgac gcccgaacgt       720
     gtgcgtcagg tgcgcgcgca actgcccgtc ttaaacaacc gtcgctttgc gccgccgcaa       780
     ttattatga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page