(data stored in ACNUC7421 zone)

EMBL: CP001509.YBER

CP001509.YBER        Location/Qualifiers
FT   CDS_pept        637074..637781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeR"
FT                   /locus_tag="ECD_00614"
FT                   /product="uncharacterized protein"
FT                   /note="similar to b0645"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00614"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42491"
FT                   /protein_id="ACT42491.1"
FT                   /translation="MDMESQKILFALSTPMEIRNECCLPSHSSPKMYLGTCFFDLSSSW
FT                   GIDDRDDLLRTIHRMIDNGHAARLAGFYHRWFRYSPCEWRDYLAELNEQGQAYAQFVAS
FT                   TAECCGEGGIKAWDYVRMGFLSRMGVLNNWLSEEESLWIQSRIHLRALRYYSNWRQYFA
FT                   GYTFGRQYWQSPEDDHLPLLREFLARKEYDDSGNDMFYQLFASDDAYYATLPWQPLADY
FT                   PTCPETLKDMSDL"
     atggacatgg agtcgcaaaa aatattgttt gcactttcca ctccgatgga aatacgcaat        60
     gaatgctgtt taccttcgca ttcatccccc aaaatgtatt taggtacatg cttttttgat       120
     ctttcttcct cctggggaat tgatgaccgt gatgacctgc tgcgcacaat tcaccgaatg       180
     atcgataacg gtcatgccgc tcggttggca ggattttatc accgctggtt tcgttattct       240
     ccatgtgaat ggcgtgacta tcttgctgaa ttaaatgagc aaggtcaggc ttatgcgcaa       300
     tttgtcgcca gcaccgccga atgctgtggc gaagggggaa tcaaagcctg ggattatgtc       360
     cggatgggtt ttttaagccg aatgggcgta cttaataact ggttgagtga agaagaaagt       420
     ctatggatcc agtcgcgtat tcatctacgg gctctacgtt attatagtaa ctggcggcaa       480
     tactttgccg gttatacctt tggtcggcaa tattggcagt ctcccgaaga tgatcatctg       540
     cctttattac gcgaattctt agcgcgtaaa gaatacgacg attccggcaa tgatatgttt       600
     tatcaattat ttgccagtga cgatgcatat tacgcgacct taccctggca accactggct       660
     gactacccca catgcccgga aacgcttaag gatatgagcg acctatga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page