(data stored in ACNUC7421 zone)

EMBL: CP001509.YBEZ

CP001509.YBEZ        Location/Qualifiers
FT   CDS_pept        complement(652212..653291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeZ"
FT                   /locus_tag="ECD_00628"
FT                   /product="heat shock protein, putative NTPase; PhoH-like
FT                   protein"
FT                   /note="similar to b0660"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00628"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42504"
FT                   /protein_id="ACT42504.1"
FT                   /translation="MFSFRRHTDKRNGLNIDTREITLEPADNARLLSLCGPFDDNIKQL
FT                   ERRLGIEINRRDNHFKLTGRPICVTAAADILRSLYVDTAPMRGQIQDIEPEQIHLAIKE
FT                   ARVLEQSAESVPEYGKAVNIKTKRGVIKPRTPNQAQYIANILDHDITFGVGPAGTGKTY
FT                   LAVAAAVDALERQEIRRILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFEMLGF
FT                   EKVEKLIERNVIEVAPLAYMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNSKAVIT
FT                   GDVTQIDLPRNTKSGLRHAIEVLADVEEISFNFFHSEDVVRHPVVARIVNAYEAWEEAE
FT                   QKRKAALAAERKREEQEQK"
     atgttcagct tccggcggca tacagataag aggaacggtt tgaacataga cactcgcgaa        60
     atcaccctgg agccagcaga caatgcgcgt ctgttgagcc tgtgcggccc gtttgatgac       120
     aacatcaagc agctcgaacg ccgtctcggc atcgagatca atcgccgcga taaccacttt       180
     aaactgaccg gccgtccgat ttgcgtcacc gctgcggcag acattctgcg tagcctgtat       240
     gtcgatactg ccccgatgcg cggtcagatt caggatatcg aaccggaaca gatccacctt       300
     gctattaaag aagcacgggt actggagcaa agcgcggaga gcgtgccgga gtacggcaaa       360
     gcggtcaata tcaaaaccaa acgcggcgta attaagccgc gcacgccaaa ccaggcgcag       420
     tacatcgcca atattctcga ccatgacatt accttcggcg ttggcccggc gggtacgggt       480
     aaaacctacc tggcagtggc tgcagcagtt gatgccctgg agcgtcagga aattcgccgt       540
     attctgctga ctcgtccggc ggtcgaagcc ggtgagaaac tgggcttcct gcctggcgat       600
     ttaagccaga aagtagaccc gtatctgcgc ccactgtacg acgcgctgtt tgaaatgctg       660
     ggctttgaga aagtcgagaa actgattgag cgcaacgtta ttgaagtcgc gccgctggcc       720
     tatatgcgtg gtcgtacgct gaacgacgcg tttatcattc tcgatgagag ccagaacacc       780
     accatcgaac agatgaagat gttcctgacc cgtatcggtt ttaactcaaa agcggttatc       840
     accggcgacg tcacgcagat cgacctgccg cgtaatacta aatcaggctt acgtcatgcc       900
     atcgaagtgc tggccgatgt cgaagagatc agctttaact tcttccacag cgaagacgtg       960
     gttcgtcacc cggtggtggc gcgtatcgtt aacgcttatg aagcctggga agaagcagaa      1020
     caaaaacgaa aagcggcgct ggcggcagaa cgcaagcgcg aagaacagga acaaaaatga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page